KEGG   Candida albicans: CaO19.12638Help
Entry
CaO19.12638       CDS       T00189                                 

Gene name
PMT1
Definition
similar to dolichyl-P-mannose:protein mannosyltransferase involved in mannosylation of serine and threonine residues
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cal  Candida albicans
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cal00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 877 aa AA seqDB search
MAKKPVTPASKVAAKQAAVRSRHQEDVFTLDPLIDPIFQKGELRSYLVTEPSPSVLKKRS
IHTKEYWMLSSLLLIAFYVRMYNLSNPNSVVFDEVHFGGFARKYILGTFFMDVHPPLAKM
LFGAVGAIGGFKGDFEFKSIGDKFPDSTPYIFMRQFPALLGVGTVILCYLTLRQSGVRPI
IAYITTFLLIIENSNVTISRYILLDSPLIFFIAAAIYAWKKFEIQIPFTFGWYRSLLATG
IALGLALSSKWVGLFTVAWVGFLCIYQLWFLIGDLSVSTKKIWGHFFARGIILLGVPIAL
YLGFFAIHFQLLNKEGDGGAFMSSAFRAGLQGNKIPRDITEQVGLGSVVTIRHVDTQGGY
LHSHEHFYQTGSKQQQITLYPHLDSNNKWLIEPYNGTIHNETFVPLINGMKIRLKHINTG
RRLHSHDEKPPVSERDWQKECSCYGYDGFAGDANDDWVVEIVNYRSQKGEAQTFVKAINT
IFRLRHAMTGHYLFSSEVKLPEWGFGQQEVTSASQGKRALTHWYIETNENSILPPSEAKI
INYPKLSLWQKVVESHKRMWKINQGLTSHHHWQSSPSEWPLLLRGINYWNKEHKQVYLLG
NAVTWWAATLSIITFGTYVLVTVFRWHLGTPLSTNKHVFNFNVQTFSYVLGWALHYLPFF
IMGRQLFLHHYLPALYFGILALGHFFEIFTGYLTSRSKYFQQVAFVLVGLFSILSLVFYV
NYSSLIYGTPWTKASCELTKPFSGWDYNCGTFFDTLGEYDIQEKSLASESEIPTETVVVE
AKQTPKAEPKLAKQDDHIESPAAAEPVEEKEVKEEVEQLAPPLAVDFEEETPKVEDPQVA
DVDASSNDEKSVEEKQQQEQQQEQEQVEDESVHQVQQ
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaccggtcacacccgcttctaaagttgctgcaaaacaggctgctgttaga
agcagacaccaagaagatgtattcacacttgatccattgatagatccaatatttcaaaag
ggagaattgcgttcgtatttggtaaccgaaccttctcctagtgttcttaaaaaaagactg
attcacaccaaagaatactggatgctttcaagtttattattaattgctttctacgttaga
atgtataatttatccaatccaaactcagtagttttcgatgaagtccattttggtgggttt
gccagaaaatatattttgggtacttttttcatggatgtacaccctccattggctaaaatg
ctttttggagctgttggagccattggtggattcaaaggtgattttgaatttaaatcaatt
ggtgataaatttcctgattctacaccttatatatttatgagacaattcccagcattgttg
ggtgttggaactgttatcttgtgctatttgactttgagacaatcaggtgttagaccaatt
attgcttatataactacctttttattgattattgaaaactccaatgtcactatttcaaga
tatattttgttagattcccccttgattttctttattgctgctgctatttatgcttggaag
aaatttgaaattcaaattccattcacctttggctggtatagaagtttattggcaactggt
attgctcttggtttagcattgagttccaaatgggttggtttgtttaccgttgcctgggtt
ggtttcttatgtatctaccaattgtggttccttattggtgatttatcagtaagtaccaaa
aaaatttggggccattttttcgcaagaggaattatcttgttgggtgtaccaattgcctta
tatcttggattttttgccattcatttccaattattaaataaagaaggtgatggaggtgcc
tttatgagtagtgcctttagagccggattgcaaggtaataaaattccaagagatattacc
gaacaagttggattaggatcagttgttactattcgtcacgttgatactcaaggtggatat
ttgcattcacatgaacatttctatcaaacaggttccaaacaacaacaaattaccttatat
cctcatttggactctaacaacaagtggttaattgaaccttacaacggcaccatccataat
gaaacttttgttcctttaattaacggtatgaagattagattgaagcatattaatactggt
agaagattgcattcacatgatgaaaaacctccagttagtgaacgtgactggcaaaaggaa
tgttcatgttatggatacgatggatttgctggtgatgcaaatgatgattgggttgttgaa
attgtcaattatagatcacaaaagggtgaagctcaaacatttgttaaagccatcaatact
attttcagattgagacatgccatgaccggtcattatttgttttccagtgaagtgaaatta
ccagaatgggggtttggtcaacaagaagtcactagtgcttcacaaggtaaacgtgcatta
acacattggtatattgaaaccaatgaaaacagtatattgcctccttcagaagccaaaatt
atcaattatcctaaattatccctttggcaaaaagttgttgaatcacacaagagaatgtgg
aagattaatcaaggattaacttcacatcatcattggcaatctagtccatctgaatggcca
ttattgttgaggggtatcaattactggaacaaagaacataagcaagtatatttgttgggt
aatgctgttacctggtgggcagccactttgtcaattatcacttttggaacctatgtattg
gttactgttttcagatggcatcttggtacacctttgtcaacaaataaacatgttttcaat
ttcaatgtgcaaactttttcatatgttttaggatgggctttacattatcttccatttttc
attatgggtagacaattgtttttacatcattatttaccagcattatattttggtattttg
gcgttgggacattttttcgaaattttcactggttatttgacttctcgttctaaatatttc
caacaagtggcatttgtattagttggattattttccattttaagtttggtattttatgtc
aattattcatctttaatctatggtactccctggactaaggcaagttgtgaattgaccaaa
ccatttagtggttgggattataattgtggcacatttttcgatactttaggagaatatgac
attcaagagaaatcattagcttcagaatctgaaataccaacagaaacagtagttgttgaa
gctaaacaaactcctaaagctgaaccaaaattggctaaacaagatgatcacattgaatcc
cctgctgctgctgaacctgttgaagagaaagaagtcaaagaagaagttgaacaattggca
ccacccttagctgttgattttgaagaagaaactcctaaagtggaagacccacaagttgct
gatgtagatgcttccagtaacgatgaaaaatctgttgaggaaaagcaacaacaagaacaa
caacaagaacaagaacaggttgaagatgaatcagtgcatcaagttcaacaatag

DBGET integrated database retrieval system