KEGG   Candida albicans: CaO19.12708Help
Entry
CaO19.12708       CDS       T00189                                 

Gene name
TRP3
Definition
likely bifunctional tryptophan biosynthesis enzyme similar to S. cerevisiae TRP3 (YKL211C) indole-3-glycerol phosphate synthase and anthranilate synthase component II
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
cal  Candida albicans
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.12708 (TRP3)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CaO19.12708 (TRP3)
Enzymes [BR:cal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CaO19.12708 (TRP3)
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CaO19.12708 (TRP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 520 aa AA seqDB search
MTTDRSSKRHVLMIDNYDSFTWNLYQYLHQSPKCGKVDVYRNDKITISQIENEIKPDIIF
ISPGPGHPLTDSGISRDIIKYFSGKIPIFGVCMGQECIFDVFGGDVSYAGEIVHGKTTTI
KHDGKGMFENVPQSVAVTRYHSLAGSSKSLPDVLEVTAVTETQPEVIMGVRHKKYTIEGV
QFHPESILTESGQLMIDNLLGVYGGTWEENDAIKTGKSIKINNKNGGENILQKIYKQREI
DYESIEKLPGKSFENLQIELDLDLAPPLINFYDRLKYTRSNLKETIILSEFKRASPSKGD
ININAHPANQALTYSTNGCSTISVLTEPHWFKGSLDDLTLIRKVIDKPTTKDYKRPAVLR
KEFIFNKYQILESRLAGADTVLLIVKMLNDETLLHELYQYSLKLGMIPLVEVNNSDELSE
ALKLTHKGTTEDPLIIGVNNRNLTTFDVDLNTTSNLVKQAKTSDRKGDVLVLALSGISSV
DDVKKYKYEDNVDGFLIGESLMRAEEKGEAGKFLHDLCTC
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgactactgacagatcatcgaaacgacatgtattaatgattgataattatgattcattt
acttggaatttatatcaatatttacatcaatctcctaaatgtggtaaagttgatgtttat
agaaatgataaaatcaccatttctcaaatagaaaatgaaattaaacccgatataattttt
atttctccaggtccaggacatccattaactgattctggtatatctagagatataatcaaa
tatttcctgggtaaaatccctatttttggtgtttgtatgggacaagaatgtatatttgat
gtatttggtggtgatgtatcatatgctggagaaattgttcatgggaaaacaactactatt
aagcatgatggtaaaggtatgtttgaaaacgtaccacaatcagtagctgtcacgagatat
cattcattagctggtagttctaaatcattacctgatgtattagaagttactgccgttacc
gaaactcaaccagaagtgattatgggggttagacataaaaaatatactattgaaggggtt
caattccatcctgaatctattttaactgaaagtggacaattaatgattgataatttatta
ggagtttatggtggtacttgggaagaaaatgatgccattaagactggtaaatcaattaaa
attaataataaaaacggaggagaaaatatattacaaaaaatctataaacaaagagaaata
gattatgaatcaattgaaaaattaccaggtaaatcatttgaaaatttacaaattgaatta
gatttagatcttgctccaccattaataaatttttatgatcgtcttaaatatactcgatct
aacttgaaggaaacaattatattatcagaatttaaacgtgcaagtccttcaaaaggggat
attaatataaatgcccatcccgctaatcaagcattgacatattctactaatggttgctcc
actatttctgttttgactgaacctcattggtttaaaggttctttagatgatttaacttta
atacgtaaagtgattgataagcctactacaaaggattataaacgtccagcggttttaaga
aaagaatttattttcaataaatatcaaattttagaaagtagattggccggtgcagataca
gttttattaattgttaaaatgttaaatgatgaaacattgttacatgaattatatcaatat
tctttgaaattagggatgattccattagtagaagtcaataatagtgatgaattatctgaa
gctttgaaattaactcataaggggacaactgaggatccattaattattggagttaataat
cgtaacttgactacttttgatgttgatttaaataccacaagtaatttagtgaaacaagct
aaaactagtgatagaaaaggtgatgtattggttcttgcattatcaggaataagttcagtt
gatgatgtgaagaaatacaagtatgaagataatgttgatggatttttaattggagaaagt
ttaatgagagctgaagaaaaaggtgaagcaggtaaatttttgcatgatttatgtacttgt
taa

DBGET integrated database retrieval system