KEGG   Candida albicans: CaO19.12722Help
Entry
CaO19.12722       CDS       T00189                                 

Gene name
LCB4
Definition
similar to S. cerevisiae LCB4 (YOR171C) sphingoid long chain base (LCB) kinase
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cal  Candida albicans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cal00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 530 aa AA seqDB search
MSSSSSTPQATGLQMSDSIKSSTDRLLYRKNDIVSAKLSSDNGIYLSGQPLQHQPKHEES
ILDTLSACYKTPDTTESDFIPFKNILNVESIAGSVDEADEVGNSNLLEITYALPFSDLNH
DLKIDKIKVDIESGPEIPPSLAQFILTESYGKSIIRPSILVLINPHGGQGHAKTIYKNKI
LPILQAARANVTYFETKYHGHATEIARELDVNDYDIIVCCSGDGIPHEVINGFYLRPDKG
LSAFNKIAVTQLPCGSGNALSLSTHGSKNASVATLYMLKAHKTKLDLMAITQGTGSEKIT
KLSFLSQCYGIIADSDIGTEHLRWLGPIRFELGVIQKVFSGAKYPCDLFVKYKYDNNSEI
LNHVNDYLSNNDTENELPIVTEENLQITSPDLDQPVPNDWRHIPQEISHNLNILYVGKMP
FVSADTQFFPAALPNDGSMDMIVTDSNNSVWKLTSILLAVESGKHIDDEKVHHTKVLSYR
LIPNIKDDSKHYISIDGEDFPFEPFQVEILPGVLTGLLQDGNFVETSFTK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcttcttctacccctcaagcaactggtttgcaaatgagtgatagtatcaaa
tcttccacagatagattgttgtaccgcaaaaatgatattgtcagtgctaagttaagctcg
gataatggtatttatttatccggacaacctttacaacatcaaccaaaacatgaagaatcg
attttggatactttaagtgcatgttataaaacccctgacacaacagaatcagatttcatt
ccatttaagaatatattgaacgtagaatcgattgcaggtagtgtcgacgaagcagatgaa
gttggcaactccaatttattagagataacctatgctttaccattcctggatttgaatcac
gacttgaagattgataaaataaaagttgatatagaaagtggcccggaaatacccccttcc
cttgctcaatttattttaacagaatcatatgggaaaagtataattcggccctctattttg
gtattgataaacccgcatggcggccaaggacacgccaaaactatttacaaaaataaaatc
ttaccaatattacaagcggctcgtgctaatgttacgtattttgaaactaaatatcatgga
cacgccactgagattgcgcgtgagctagatgtcaatgattatgatataattgtttgttgt
tctggcgatgggatacctcatgaagttatcaatggcttctatcttcgtccagataaaggt
ttactggcattcaacaaaattgcagttactcaattaccttgtgggtcagggaacgcgttg
agtttgagtacacatggtagtaaaaatgcttcagttgcaactctttatatgttgaaagct
cataagacaaaattggatttgatggctattacccaaggtacaggaagtgaaaagataacg
aaattgtcatttttaagtcagtgctacggtattattgctgattctgatattggaacagaa
catttacgttggttgggtcctatacggtttgaacttggagtgatacaaaaagtgttctcg
ggggcaaaatatccttgtgacctatttgtgaaatacaagtacgataataattcagagatt
ttgaatcatgtaaatgattacttgagtaataatgatactgaaaacgagttacccattgtc
actgaagagaacttgcaaataacgagccctgatttagatcaacctgtccccaatgattgg
agacatattcctcaagaaatttctcataatttgaacatcttgtatgttggcaaaatgcca
ttcgtgtctgcagatactcagtttttccctgctgctctaccgaacgatggttcaatggac
atgattgtcaccgattccaataactcagtgtggaaattgacatcgatattattggcagtt
gaaagtgggaaacatattgatgatgaaaaagtgcaccatacaaaagttttgagttatcgt
ttgataccaaacattaaagatgatagcaaacactacatatctattgatggcgaagatttc
ccttttgaaccttttcaagtggagattttgccaggtgtgttgacaggattactacaggat
gggaactttgtagaaacatcatttaccaaatag

DBGET integrated database retrieval system