KEGG   Candida albicans: CaO19.12832Help
Entry
CaO19.12832       CDS       T00189                                 

Gene name
HOS2
Definition
histone deacytylase family protein similar to S. cerevisiae HOS2 (YGL194C) component of the SET3 complex involved in ribosomal protein gene histone deacetylation
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CaO19.12832 (HOS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 454 aa AA seqDB search
MTISISETDTFTTDIKTRENTPIYDPNHPGTNNKYNVSYHYNPEVSRFHYGALHPMKPFR
LMLTDHLVISYKLYEKMDLYTPRRATKDELLEFHSEDYIDFLQSITPEKCKTISNDTLAQ
FNIGDDCPIFDGMYDYSAIYAGASLDATRKLISGMSDIAINWSGGLHHAKKFEPSGFCYV
NDIVLSIINLLRVHPRVMYIDIDLHHGDGVQEAFYNTDRVMTVSFHKYNGEFFPGTGSVD
EVGIGSGKNYAINVPLRDGIDDESYIRLFKSIMEPLITKFQPTCIVQQCGADSLGYDRLG
CFNLNIRAHGECVKFIKSFGIPMLVVGGGGYTPRNVSRLWCYETSVLNDVNLDHKIPNYL
PTYDWFGPDYSLHPQLDGRIDNKNSKKYLQSVQTTIMEQIRYLNHAPSVQMYEIPPDLTG
LTEDEDKAIQELNEDMERDEKIMKDETKLGELMT
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactgataagtgaaacagatacgtttacaaccgatatcaagactcgagaaaac
accccaatatatgatcctaatcatcctggcactaataacaagtacaatgtttcataccat
tataatcctgaagtgagtcgatttcattatggtgcccttcatccaatgaagccatttcga
ttaatgttgactgatcatttagttatatcttataaattatatgaaaaaatggatttatat
acacctcgaagggcaacaaaagatgaattactagagtttcattctgaagattatattgat
tttttacaatcgataactcctgaaaaatgtaaaactataagtaatgatacattagcacaa
ttcaatattggagatgattgtccaatatttgacgggatgtatgattatagtgccatttat
gccggggcatcattggatgccacaaggaaattgatatcaggaatgtcagatattgccatc
aattggtcaggtggattacatcatgctaaaaaatttgaaccatcggggttttgctatgtt
aatgatattgtgttgagtataataaatttactaagggtacatccacgagtaatgtatata
gatattgatttacatcatggtgatggggttcaagaagcattttataatactgatagagtg
atgactgttagtttccataaatataatggtgagtttttcccaggtacagggtcagttgat
gaagttggaattgggtcggggaaaaattatgctattaatgtaccgttgagagatggtata
gatgatgaatcatatattcgattatttaaactgattatggaaccgttaatcacgaaattt
caaccaacgtgtattgttcaacaatgtggagccgattctttggggtatgatcgtttgggt
tgttttaatttgaatattcgagctcatggtgaatgtgttaaatttattaaatcatttgga
ataccaatgttggttgttggcggtggtgggtatactccaagaaatgtcagtagattatgg
tgttatgaaacgagcgtattgaatgatgtcaatctagatcataaaatccctaattatttg
ccaacgtatgattggtttggtcctgattattcgttgcatccacaactagatggtagaatt
gataataagaattcgaaaaaatatcttcagagtgtgcaaactactattatggaacaaata
cgatatttaaatcatgctccaagtgtgcaaatgtatgaaattcctcctgatctaactggt
ttaactgaggatgaagataaggcaattcaagaattaaatgaagacatggagcgagatgaa
aagattatgaaagatgaaaccaaactaggagaactaatgacttag

DBGET integrated database retrieval system