KEGG   Candida albicans: CaO19.12871Help
Entry
CaO19.12871       CDS       T00189                                 

Gene name
ESA1
Definition
similar to S. cerevisiae ESA1 (YOR244W) NuA4 histone acetyltransferase complex catalytic subunit
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 541 aa AA seqDB search
MAVAEIKKEKGSSLSPEPSSPIQILSTEPDANTDIKQEKFTPKDILPGCKVHVSKDGEFR
LAEILQEHIKKGRKVFYVHYQDFNKRLDEWIELDRIDFTRSLILPEIKADTKENKSKKKS
KSKGQTKLSKNNTTANSTTGTPQPSDGQPIMGDDEMDLENLNVQGLKRPGEEFSREDEIK
KLRTSGSMTQNHSEVARVRNLSTIILGEHIIEPWYFSPYPIELTEEDEIYICDFTLSYFG
SKKQFERFRSKCSMKHPPGNEIYRDSKVSFWEIDGRKQRTWCRNLCLLSKLFLDHKTLYY
DVDPFLFYIMTIKSDQGHHVVGYFSKEKESADGYNVACILTLPCYQKRGFGKLLIQFSYM
LTKVERKVGSPEKPLSDLGLLSYRAYWTDTLVKLLVERNSPALFRKNNSQLEYDEAENGK
DSSATPTPGPGSNASQSSILASAAASRSGLNSSPIFSNEITIEDISSITCMTTTDILHTL
TTLQMLRYYKGQHIIVLTDQIMELYEKLVKKVKEKKKHELNPKLLHWTPPSFTANQLRFG
W
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagcagaaatcaaaaaagaaaagggttccagcttgtcgcctgaaccttcttcg
cctattcaaatactaagcactgaaccagatgcaaatacagatattaagcaggagaaattt
acaccaaaagatatattaccaggatgtaaagtacatgtttccaaagatggagaattcagg
ctagcagaaattttacaagagcatattaaaaagggtcgtaaggtattctatgtgcattac
caagattttaacaaacgtttagatgaatggattgaactcgacaggatagactttactcga
agtcttattttaccagaaataaaagcagacacaaaggaaaataaactgaaaaagaagagc
aaatccaaaggacagacaaagttgtccaaaaataatactactgccaatagtacaaccggt
accccacagccaagtgatggacaacctattatgggagatgatgaaatggatttggaaaac
ttgaatgtccaaggtttgaaacgcccgggagaagaattcagcagagaagatgaaattaaa
aagttacgtacgagtggttccatgacccaaaatcatctggaggtggcaagagtaaggaat
ttgtcaacgattattttgggtgaacacattatcgaaccttggtatttctctccataccct
attgaattgacagaagaagatgagatatacatttgcgattttacactatcctattttgga
tccaaaaaacagtttgagagatttcgttcaaaatgttcaatgaaacacccgccaggtaac
gagatataccgagattcgaaagtcagcttttgggaaatagacggcagaaagcaaagaaca
tggtgtcgaaatttgtgtctattaagtaaattgtttcttgatcataagacattgtactat
gatgttgatccctttttgttttacatcatgaccatcaaatccgaccaaggtcatcatgtc
gtggggtatttttctaaagaaaaagaaagtgcagatggatataatgtggcgtgtatttta
actctaccctgctatcaaaaaagagggtttgggaaattgttgatccagttttcatacatg
ctaacgaaagttgaaagaaaagtaggttcgccagaaaagccattatcggatttgggattg
ttgtcatatcgtgcctattggacagacacattggtaaagctattggtagaaagaaacagt
cctgctttattccgtaagaataattctcagttagagtacgatgaagctgaaaatggcaaa
gacagctctgcaacaccaacaccggggccaggttcaaatgcctcccaatcatctatattg
gctagtgctgctgcatcaaggctgggacttaattcatcgcctattttttctaatgaaatt
accattgaggacatttcatccataacatgcatgaccacgacagatatactacacacatta
accacattacagatgttgcgatactacaagggacaacacataattgtgttaaccgatcaa
ataatggaattgtatgaaaaactagttaaaaaggtaaaagagaaaaagaagcatgagtta
aatccaaaattattgcactggacaccacctctgttcactgcaaaccaattacggtttggg
tggtaa

DBGET integrated database retrieval system