KEGG   Candida albicans: CaO19.13067Help
Entry
CaO19.13067       CDS       T00189                                 

Gene name
GLC3
Definition
likely glycogen branching enzyme; similar to N. crassa be1 (B8B20.330) and to S. cerevisiae GLC3 (YEL011W); N terminus of this allele is a better match
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cal  Candida albicans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CaO19.13067 (GLC3)
Enzymes [BR:cal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CaO19.13067 (GLC3)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CaO19.13067 (GLC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 676 aa AA seqDB search
MSKSLIQGVLDLDPWLEPFSQPLINRQIEFQKWHKKLIESEGSLIDFANSYKKYGVHTLP
SGEIQIIQYIPDVDEVSIVGDFNNWNKDSHKLRKLNEFGTWELTLKPGSIPIDSKYKIAM
KTTTKNGGEWIYRLDPWVHRATFAKQHALYEGHFWEDNYQFKNPRPKKNIAAGGIKIYEA
HVGISTPEPTIGSYKNFTQNVLPIIRDLGYNTIQLMAIMEHAYYASFGYQVTSFFAISSR
YGTPDELKELIDTAHGMGIQVLLDVVHSHSSKNVDDGLNMFNGTDHYLFHGGSRGNHDLW
DSRLFNYTNYETLRFLLSNLKYYIDVFQFDGFRFDGVTSMLYKHHGLSVGFSGGYHEYFG
DGVDNEAIVYLMLAHQLMNEISTTQNFNLTSIAEDVSGMPTLCRPISDGGIGFNYRLSMA
IPDMWIKILKHLTDEQWDLGNIVHTLTNRRYGEKVIAYCESHDQALVGDKTLAFWLMDKE
MYTNMSVLSPLTPIIDRGIALHKLIRLVTFALGGDGYLNFEGNEFGHPEWLDFPRQGNGE
SYHYARRQFNLINDDLLRYKYLYQFDKKMLQLEITNTGEYVSLKHEGDKVLVFEKGKSVY
IFNFNPTQSFVDYRIGVELPGTYKLVLDSDSEDLGGHGRLDHNTKYFTFNEPWNNRSNSL
LVYIPTRTAIVLEKVE
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatcattaattcaaggagtattagacttagatccatggttagaaccattttct
caaccattaattaatcgacaaattgaatttcaaaaatggcataaaaaattaattgaatca
gaaggttcattaattgattttgctaatagttataaaaaatatggtgtacatactttacct
tctggtgaaattcaaatcattcaatatattcctgatgttgatgaagtttcaattgttgga
gattttaataattggaataaagatagtcataaattacggaaattaaatgaatttggaact
tgggaattgactcttaaaccaggtagtatccccattgatagtaaatataaaattgccatg
aaaaccaccaccaaaaatggcggggaatggatttatcgtttagatccatgggttcataga
gctacatttgctaaacaacatgcattatatgaaggtcatttttgggaagataattatcaa
tttaaaaatcctcgtcctaaaaaaaatattgccgcaggtggtattaaaatttatgaagct
catgtaggtatttctactccggaaccaactattggtagttataaaaatttcactcaaaat
gtcttgccaataattcgtgatcttggttataataccattcaattaatggcaattatggaa
catgcttattatgcatcatttggttatcaagtgacgagttttttcgccatctcatctcga
tatggtacccctgatgaattaaaagaattgattgataccgctcatggaatgggaattcaa
gtattattagatgtggtccattctcatagttcgaaaaatgtcgacgatggattaaatatg
tttaatggtactgatcattatttatttcatggtggtagtagaggcaatcatgatttatgg
gattctcgattatttaattatacaaactatgaaactttaagatttttattatctaatttg
aaatattatattgatgttttccaatttgatggctttagatttgatggggttactagtatg
ctttataaacatcatggattatctgttgggttcagtggtggatatcatgaatattttggt
gatggagtcgataatgaagctatagtttatcttatgttagctcatcaattaatgaatgaa
atttccaccacccaaaatttcaatttgacttcaattgcggaagacgtttccgggatgcct
acattatgtcgtccaatatctgatggaggaattggtttcaattatagattatcaatggca
atccctgatatgtggattaaaattttaaaacatttaactgatgaacaatgggatcttggt
aatattgttcatacattaaccaatcgaagatatggtgaaaaagtcattgcttattgcgaa
tctcatgatcaagctttggttggagataaaactttagccttttggttaatggataaagaa
atgtataccaatatgtcagtattatccccattaacaccaattattgatagaggtattgcc
cttcataaattaatccgtttagtcacttttgcccttggtggtgatggatatctcaatttt
gaaggtaatgaatttggtcatcctgaatggttggatttccctcgtcaaggtaatggagaa
tcttatcattatgctcgtcgtcaattcaatttaattaatgatgatcttcttcgttataaa
tatttatatcaatttgataaaaaaatgttacaactagaaatcaccaatactggggaatat
gtttctttaaaacatgaaggtgataaagttttagtatttgaaaaaggtaaatcagtttat
attttcaatttcaatccaactcaatcatttgttgattatagaattggggttgaattacca
gggacttataaattagtattggattctgattcagaagatttaggtggtcatggaagactc
gatcataatactaaatatttcacttttaatgaaccttggaataatagaagtaattccctt
ttagtttatattccaactagaactgccattgtcttagaaaaagttgagtag

DBGET integrated database retrieval system