KEGG   Candida albicans: CaO19.13268Help
Entry
CaO19.13268       CDS       T00189                                 

Gene name
TFB2
Definition
component of RNA pol II transcription initiation TFIIH
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cal  Candida albicans
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:cal03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cal03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 494 aa AA seqDB search
MSSHLFKATVNEYLEGLPKTVQSKLYEAPATCLSIFRLLSPMAKFYIMSMIFNEKPIALR
DLDKWCKPSARKLEFEALKRLESLHLIEYDSKGSHVRLHSIFRKNFRDCLTGSQNPNAFG
SISTTVDKHKVDIPFLDLFASQKWETILHFMVGTESTATPSDSVLSLLKLGGLMEGPNND
LRITNSGFQFLLQDVNAQIWTLLLQYLNLTQELNMDPVDVLNFIFVLGSLELGKSYSVLS
LSETQVSMLADLKDYGLVYQRSDTSGRFYPTRLATTLTSDSAALKTPSMAMDEEEQQVAT
KESIIIETNFKIYAYTKSPLEIAILNLFVHFKTRFANMVCGQITRESIRNALYNGITADQ
IIKFLETHAHPQMRILAKEKLDKKIEFDTSHNINTAGGAPQSKTDGMVSQHKLEILPPNV
VDQIKLWQLELDRIQTFDGYLFKDFSNQQEYDILSNYASELGVLIWADKVKKKFFVTKDG
MTQVADFANRKLKR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcacttgttcaaggcgacggtaaatgaatatctcgaaggactcccgaaaaca
gtccaatccaaactatatgaagcaccagctacgtgtttgtcgatattccgattactttcg
ccaatggccaaattctacatcatgtcaatgatattcaatgaaaaaccaattgcattaaga
gatttagacaaatggtgtaaaccactggcgaggaaattggaatttgaagcattgaagaga
ttggaatctctacatttaatagaatatgatagtaaaggttctcatgtcagattgcattct
attttcaggaaaaactttcgtgattgtttgacaggatcacaaaatccaaatgcatttgga
agtataagtaccacagtggataaacataaagttgatataccattcctagatttgtttgca
tcgcagaaatgggaaactattttacatttcatggtgggtaccgaatcaacggccactcct
tctgattcagttttaagtctacttaaattgggtggattaatggaaggccccaacaatgat
ttaagaattacaaatagtgggttccagtttttgttacaagatgttaatgcacaaatttgg
acattgctattacaatatttgaacttgacacaggaattgaatatggatccagttgatgtg
ttgaattttatatttgtattggggtcattggaattgggtaaaagttactctgtattaagc
ttaagtgaaactcaagtgagtatgttggcagatttaaaagattatgggttggtttatcaa
cgatcagacacttctggaaggttctacccaacaagattggcaaccacgttaacttctgat
tcagcagcattgaagacgccatctatggcaatggatgaggaagaacaacaagttgcaaca
aaggaatcgattatcatagaaacaaatttcaaaatttatgcatacacaaagtcaccatta
gaaatagccattctaaatttgtttgtgcattttaaaaccagatttgccaatatggtatgt
gggcaaattacaagagaatctataagaaacgccttatataatggtataactgcagatcag
attatcaaatttttggaaacccatgcacatccacaaatgagaatattagcaaaagagaaa
ttggataaaaaaattgaattcgataccagtcacaatatcaatactgctggtggtgctcct
caaagtaaaactgatgggatggtttcacaacataagttggaaatactccctcctaatgtt
gttgatcagatcaagctatggcagttggaattagatagaattcaaacttttgacggatac
ttgtttaaagatttctccaatcaacaagaatatgatatattatctaattatgcttctgag
ctaggggtattgatctgggcagataaagtgaagaagaaattctttgtcactaaagacggc
atgactcaagttgctgattttgcaaacagaaaattgaaacgttga

DBGET integrated database retrieval system