KEGG   Candida albicans: CaO19.13545Help
Entry
CaO19.13545       CDS       T00189                                 

Gene name
KGD2
Definition
Dihydrolipoamide S-succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cal  Candida albicans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.13545 (KGD2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CaO19.13545 (KGD2)
  Amino acid metabolism
   00310 Lysine degradation
    CaO19.13545 (KGD2)
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CaO19.13545 (KGD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 441 aa AA seqDB search
MLSRSIKSSLKRTTALARPTAAKSALKIANASSVRSLHIKNTSSYRPTPFLTFQRYASVS
VKVPDMAESITEGTLAAFNKEVGDFVSQDETIATIETDKIDVEVNAPVSGTITEFLVDVD
ATVEVGQEIIKMEEGDAPAGGASASEAPAKKEEAPEKAKEESAPAAAPKKEETKKEEPKK
ESKPAPKKEESKKSTQSTTSAPTFTNFSRNEERVKMNRMRLRIAERLKESQNTAASLTTF
NEVDMSNLMDFRKKYKDEFIEKTGIKLGFMGAFSKASALALKEIPAVNAAIENNDTLVFK
DYADISIAVATPKGLVTPVVRNAESLSILGIEKEISNLGKKARDGKLTLEDMTGGTFTIS
NGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRVVDGREA
VIFLRTIKELIEDPRKMLLLE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttatcaagatctattaaatcatcattgaagcgtactacagctttagccagaccaacc
gctgccaagtctgctttgaaaatcgccaatgccagttcagtgagatccctccatattaaa
aacacttccagctatagaccaacaccattcttgactttccaaagatatgccagtgtttct
gtcaaagtgccagatatggctgaatctattaccgaaggtactttagccgccttcaacaaa
gaggttggggattttgtcagccaagacgaaacgattgccaccattgaaaccgataaaatc
gatgttgaagtcaatgctccagtgtcaggtactattactgaatttttagttgatgttgat
gccactgttgaagttggccaagaaatcattaagatggaagaaggcgacgccccagccggc
ggtgcatctgcatctgaagctccagctaagaaagaagaagcccctgaaaaggctaaagaa
gaatctgctccagctgccgcaccaaagaaggaagaaactaagaaagaggaaccaaagaag
gaatcaaaaccagctccaaagaaagaagaatctaagaagtccacccaatctacaactagt
gctccaactttcaccaatttctccagaaacgaagagagagttaagatgaacagaatgaga
ttgagaattgctgaacgtcttaaggaatcacaaaacactgctgcttccttgaccactttc
aacgaagttgatatgtctaacttgatggatttcagaaagaaatacaaggacgaatttatt
gaaaagaccggtatcaagttaggattcatgggtgctttctccaaagcttctgccttggct
cttaaggaaatcccagctgtcaatgctgcaattgaaaacaatgacactttggtctttaaa
gattatgccgacatttcaattgctgttgccactccaaaaggtttggtgacccctgttgtc
agaaacgccgaatccttatctattttgggtattgaaaaggaaatctctaatttgggtaag
aaagccagagatggtaaattgactttggaagatatgaccggtggtactttcactatttct
aatggtggtgtttttggatcattatacggtaccccaattatcaatatgcctcaaactgcc
gtattaggtttacacggtgttaaagaaagaccagttactgttaacggacaaatcgtttct
agaccaatgatgtacttagcattgacttacgaccacagagtagttgacggtcgtgaagct
gttattttcttaagaaccatcaaggaattgattgaagatccaagaaagatgttgttgtta
gaataa

DBGET integrated database retrieval system