KEGG   Candida albicans: CaO19.13651Help
Entry
CaO19.13651       CDS       T00189                                 

Gene name
YUH1
Definition
potential ubiquitin carboxyl-terminal hydrolase similar to S. cerevisiae YUH1 (YJR099W)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 258 aa AA seqDB search
MTKGDSKRVIPLESNPFLFTELAYQLGLSPILQFHDVYSLTDPDLLAMLPTPIYAIILLF
PLSPNYEKYRQQQDNNNNNNFNSTNLIKYDNNNDIEWFKQTIGNGCGLYALLHILTNLPQ
DLIISNSKLSQLRNNLTKVKEFSIDDRAKIIENLENDIKLDENFGEKGDTKAPDINESVD
LHFISFIKSTKNGHLYELDGRRTGPIDLGESNNKDNNNNNNNIINDPLLIEKIQFYIDNA
DEANKNNFAIMAIGPSFN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaggtgattctaaaagagtgattccattagaatcaaatccatttttattcacc
gaattagcttatcaattaggattatcaccaatattacaatttcatgatgtttattcttta
actgatcctgatttattagcaatgttaccaacaccgatatatgccattatattattattc
ccattaagtcccaattatgaaaaatatcgtcaacaacaagataacaacaacaacaacaac
ttcaattctacaaatttgataaaatatgataataataatgatattgaatggtttaaacaa
acaattggtaatggatgtggattatatgctttattacatattttaactaatctacctcaa
gatttaatcatttcaaattctaaattatcacaattaagaaataatttgaccaaagttaag
gaattttctattgatgatcgagcaaaaattattgaaaatttagaaaatgatattaaatta
gatgaaaattttggtgaaaaaggtgatactaaagctcctgatattaatgaatcagttgat
ttacattttatttcatttattaaaagtacgaaaaatggtcatttatatgaattggatggt
agaagaactggtcctattgatttaggtgagtcgaataacaaggacaataataataataat
aataatattattaatgatcctttattgattgaaaaaattcaattttatattgataatgct
gatgaagcaaataaaaataattttgcaattatggctattggtccttcctttaattga

DBGET integrated database retrieval system