KEGG   Candida albicans: CaO19.13754Help
Entry
CaO19.13754       CDS       T00189                                 

Definition
potential patatin-like phospholipase with cyclic nucleotide binding domain; similar to S. cerevisiae YML059C predicted ER hydrolase
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cal  Candida albicans
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CaO19.13754
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CaO19.13754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 1386 aa AA seqDB search
MGPEFEDSIPLVHSDNRTTTIYSVYIIISDIFSFVQWLLFKVLNLIIIDSPAFVLRLLSK
NFEINLHLSSILATLIGVSVVTYLVIRYKFLTGYSHSNDQKEGAGKKGIHPASSKVFVGK
SKQDKKPSNYLDEFLLAIKVFGYLDKAVFHELTKSMTTQKLSHEEILCLDESLGFSIVVE
GVAQVYTKKSKENSSKYKQRYFEEIEEERDEFLILGDKQYQLLNEVKSGAPLSSLFSTLD
LFRPRNKNEEMALTPNDEDGNSVVALNMDYLSKSEPATDSKLSNSDDDENGQDYPEIIVR
PKKSHNNGTITIAIIPHTAFERVQSKYPKATSHIVTMVLTRLYKVTMSTVQNYLGLTSEI
LKSEIKLNEENATSLPRYFVDGLLERLNKKEEAEAEAENLPKKLKHHHRNQLQRTTSRYV
SLDSKVKSNHPGDLLSSVPISRSEFQKKVLPKSSTTSLSDGDNKRMNFTDEMEETEENSL
RVAIIENIFKMVGIEETNGIVERTGYFQSLSSSTSSSIVGLDSLNQSIMSGATTPTTKRS
HPVFNNQGSLMNTINLAELRKPSTAENSTLPKLSGKKRLLSDMNIKDAFAKSLEIKYIGP
DSTIVSQNSAITGLYYVIDGSLEIYNRSADVSAPNRYIYTVESGGIAGYLTSVVGFRSMV
TIKTPKKTGAVVAYIPKNDYNKLLDKYYFLQLPVALKLKNLLSKQILTIDYALEWCHIPA
GEVLCSQGDLANGFHVVLSGRFRVVRSTNKNTEKEDVEVLGEYGHGESIGEVEVLTASRR
SNTLIAVRDSETARIPRSLFEMLSNENPSIMVSVSRLVASKVLASQYQPRERNFITSTTS
QESFTSANYKTITILPTVSGLPVRQFAEKLVQALRQIGRNVIALDQASILTHLGRHAFDE
SLARLKLSGYFAYLEEEYETIVYICDTPVQSNWTSTCISQGDCILLLADAEDDSTTIGEY
EQLLVKLKTTARTDLCLLHQDKVVRAGSTSPWLKNRIWVQGHHHIQMKFEQGANVLPHKK
SFISDLAAKLSQNKAIKSTFEATKQHIKWYVKENDQSKVLKIYKDDFMRLARILSNEAVG
LVLGGGGSRGISHVGVVTSLERHGIPVDIIGGTSIGSFVGGLYAKEYNIVSIYAMAKKFS
KRISSVWRMLFDLTYPVTSYITGYEFNRGIWKVFGFAEIEDFWIKYFCNSANITNSTMDI
HEKGYAWRFIRASMSLAGLLPPIAFNGCMLLDGGYLDNLPVNEMKKRGVKHIIAVDVGSV
DDRTPMNYGDTLSGFWVLLNRWNPFSSHPNIPTMMDIQMRLTYVSSVNALEEAKRTPGVY
YLRPPIDPYATLDFGKFDEIYKVGLKYADDLFADWKSKGKFPRIAGLVEKKKDGEEKKIL
YRRNSI
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgggccctgaattcgaggatctgataccgttggtgcattcagacaatagaactacaacc
atatacctggtatatattataatcagcgatatttttctgtttgttcaatggctattattt
aaagtgttgaatctcatcattattgattctccagcattcgttctacgccttctttcaaaa
aattttgaaataaatttgcatttatcttcaatattggcgacactaattggggttagtgtt
gtgacctatttggttattagatataaatttctaactgggtactctcatagcaacgatcaa
aaagaaggggcaggtaagaaaggcattcatccggcttcctcgaaggtatttgttggaaaa
tcaaagcaagacaaaaaaccaagcaattacttagatgagtttttactagcaattaaagtt
tttggatacttggacaaggcggtgttccacgaattgacgaaaagtatgactacacagaaa
ttgtcgcatgaggaaatattatgtttggatgaatccttggggtttctgatagtcgtcgaa
ggggttgcccaagtgtatacaaaaaagtccaaggagaatctgctgaaatataaacaacgc
tattttgaggagattgaagaggagcgagatgagtttttgattcttggtgacaagcagtac
caacttttgaatgaagttaaaagcggtgctccattgagttcgttgttctccaccttagac
ttgtttaggccaagaaataagaatgaggaaatggctttgactccaaacgatgaagacggg
aatagcgtcgttgcattgaatatggattatttgagtaaatcagaacccgcaaccgattcg
aagttgagcaacagtgacgatgatgaaaatggtcaagattatcctgaaataattgtcaga
ccgaagaagtctcataataatggcaccattactatagcaatcatcccacacaccgccttt
gagcgcgttcagctgaagtacccaaaggcaacttctcatattgtcacaatggttttgact
aggttgtacaaggttacaatgagcactgtgcaaaactaccttggtttgaccagtgaaatt
ttgaaactggagatcaaattgaacgaagaaaatgctacgagtctaccaagatactttgtc
gacggtttattggaaaggttgaacaaaaaagaagaggccgaggccgaggccgagaacttg
ccaaagaagctcaagcatcatcatagaaaccaattacaaaggactacgtcgaggtatgtg
tctttagattccaaagtaaaaagcaatcatccaggtgacttgctttcgtcggtgcctatc
tcccgaagcgagttccaaaaaaaggttctcccaaaatcttccaccacttcattgctggat
ggggataacaaaagaatgaactttactgatgaaatggaagaaactgaagagaactcttta
cgagttgcgataattgaaaacattttcaagatggttggtattgaagaaactaatggtata
gttgaaaggactggatatttccaaagcttaagctcgtcaacaagtagttcaattgtgggc
ttggatagcttgaatcagtcaattatgtccggtgcaaccactccaaccaccaaaagatcg
catccggtattcaacaatcagggaagtttaatgaacacgataaatttagctgaattgaga
aaaccatcaactgctgaaaactcaacgttgcccaaactttctggaaagaaacgtttgtta
tcagacatgaatatcaaagatgcatttgctaaatccttagagatcaagtatattgggccg
gattctacgattgtgagtcagaattcggcaattactgggttgtactatgttattgacgga
tctttggaaatttacaaccgctctgcagatgtttctgctcctaatcgatacatctataca
gttgagtctggtgggattgctggatatttgacttctgttgtcgggttcagatcgatggtg
acaataaagacccccaagaaaaccggtgcagttgtcgcatacataccaaagaatgactac
aacaagttgttggacaaatattactttttgcaattacccgttgcacttaaacttaaaaac
ttgttatccaagcagatactcacaattgattacgcattagagtggtgtcacatacctgcg
ggtgaagtcttgtgctcacaaggtgacttggccaatggattccatgtcgttttgagtggg
cggtttagagttgttagatcgacaaacaaaaacactgagaaggaagacgttgaggttttg
ggcgagtatggacatggcgaatctattggtgaagttgaagtgttgacagcttcgagaaga
tcaaacacgttaattgcggttcgagattcagaaacagcacgtattccaagatcattattc
gaaatgttatccaatgagaacccatccataatggtaagtgtttcgcgtttagttgcatcc
aaggtactcgctctgcagtatcaaccacgggagcggaactttattacttcaaccacttcc
caagagtcttttacatcagcaaattataaaacaatcactattttacccaccgtgtctggt
ttaccggtgcgacaatttgcagaaaagttagttcaggcattaaggcagattggccgaaac
gttattgcgttagaccaggctctgatattgactcatttggggagacatgcgtttgatgaa
agtttggcgaggttgaagctactgggatattttgcgtatttggaagaagaatacgaaact
atagtatacatttgcgacaccccagttcagtctaattggacatcaacgtgcatctctcaa
ggcgactgtattttgttattagcagatgccgaggatgatagcacgactattggtgagtat
gagcaattattggtcaaattgaaaactacagccagaacagatttgtgtttgcttcaccaa
gacaaagttgttagggcagggtctactagtccatggttgaaaaatagaatatgggttcaa
ggacaccaccatattcaaatgaagtttgaacaaggagcaaatgttttaccacacaaaaaa
tcgtttataagcgatttagcagcgaagctttcgcagaataaagcaataaagtctactttt
gaggcaacaaagcagcacattaaatggtatgtcaaggaaaatgaccaaagcaaggtgttg
aaaatatacaaggacgactttatgagattggctcggattctttccaatgaagcagtgggt
cttgttttgggaggcggtggctcaagaggtatatcccacgttggtgttgtgacgagttta
gagcgacatgggattcccgttgacattattgggggcacatccattgggtcttttgttggt
gggttgtatgccaaggagtacaatattgtctccatttatgctatggcgaaaaagttttca
aaaagaatatcttcggtttggcggatgttattcgatttgacctacccggtcacttcgtat
attacaggttatgaattcaaccgtggtatatggaaggtttttggatttgctgaaattgag
gatttttggatcaagtatttttgtaactcggcaaacatcacaaactccacgatggatatc
cacgaaaaaggatatgcgtggaggttcatccgtgcgtcaatgtcgcttgcaggtctttta
ccccctatcgcatttaatggatgtatgttactagatggtggttatttggacaacttgcct
gtgaatgagatgaaaaaaagaggtgtcaagcatattattgctgtcgatgttggttctgtt
gatgatcgtacaccaatgaactatggggacactcttctgggattttgggttttgctcaat
cgatggaaccccttttccagtcaccctaacattccaacaatgatggatattcaaatgaga
ttgacttatgtttctagtgtcaatgcattagaggaggccaagagaacccctggtgtttac
tatttgcgaccacctattgatccttatgcaactttagattttggaaagtttgacgagatt
tacaaagttggactcaagtatgcagatgacttgtttgccgattggaaaagcaaaggtaaa
tttccaagaattgcaggattggttgagaagaaaaaggatggtgaagaaaagaaaatactt
tatcgaagaaactctatctag

DBGET integrated database retrieval system