KEGG   Candida albicans: CaO19.13893Help
Entry
CaO19.13893       CDS       T00189                                 

Gene name
PFK2
Definition
phosphofructokinase beta-subunit that can functionally substitute for S. cerevisiae PFK2 (YMR205C)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CaO19.13893 (PFK2)
   01230 Biosynthesis of amino acids
    CaO19.13893 (PFK2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.13893 (PFK2)
   00030 Pentose phosphate pathway
    CaO19.13893 (PFK2)
   00051 Fructose and mannose metabolism
    CaO19.13893 (PFK2)
   00052 Galactose metabolism
    CaO19.13893 (PFK2)
  Energy metabolism
   00680 Methane metabolism
    CaO19.13893 (PFK2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CaO19.13893 (PFK2)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CaO19.13893 (PFK2)
Protein phosphatases and associated proteins [BR:cal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CaO19.13893 (PFK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 946 aa AA seqDB search
MISIVNGTSTLSLVAGSVETLNQAINFYTNILGLSVHSEQNDWTYLSNDDNKMIVKIQLD
TKSGLSLDQINDRRTEIIAKLNITDWRSLDTTSVLKVQNLVALIETLTTFNYTLQITPNE
LYPNEVYCVDPLGYIIGFTACDEPLTLVPPLQKSHPKPGLVSNLMSKSGSQSRNIEETKA
VRRNIAVMTSGGDSQGMNAAVRAVVRATIFHGSKAFAVQEGYAGLVKGGPEYIKEMKWQD
VRGFLSEGGTNIGTARCMEFKERWGRLKGCKNLIDAGIDGLIVCGGDGSLTGADLFRHEW
PSLIQELKDKGEITNEQFERHKHLYICGMVGSIDNDMAMTDATIGGYSALERICRAIDYI
DATANSHSRAFVVEVMGRHCGWLALMAGIATSADYIFIPEKPASSKDWQDQMCDIVGKHR
AQGKRKTIVIVAEGAITSDLKPITSDEVKDVLVDRLGLDTRITVLGHVQRGGTAVAFDRT
LATLQGVEAVKAILELTPDVPSPLIAIDENKICRRPLVEAVRITKSVASAIEAKDFEKAM
SLRDHEFKEHLANFMAMNTANHEKPTLPREKRKKIAIINIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLSRHESVKSIEWIDIEGWNSIGGSEIGTNRQTPEETDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLERSRAMYPSFRIPMVLIPATISNNVPGTEYSLGADTCL
NSLMEYCDIVKQSASATRGTAFIIDVQGGNSGYIATFASLISGAQASYVPEEGISLQQLE
MDINSLREAFAVEQGMTKSGKLIIKSSNASKVLTPHTLADIFNDECHGDFDTKTAIPGHV
QQGGLPSPIDRSRGDRFAIRAVQFIEDHCDVLAPYRYELDFPIDDKKILNTAAVLGIKSS
RLRFTSIRHLFDFETELGRRMPKTIYWNTIRDISDQLVGRTRLDKP
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattgttaatggtacttccacactttcattggttgctggtagtgtggaaact
ttaaatcaagcaatcaacttctataccaacatacttgggttgtccgtccattcggaacaa
aatgactggacatatttatcaaatgacgacaataaaatgattgtcaagatacaattagac
accaaatctgggttatcgcttgaccaaatcaatgatagaagaacagaaattattgccaaa
ttgaatatcactgattggagatcattggacaccaccagtgttttgaaagttcaaaattta
gttgctttgattgaaactttaaccacattcaactacactttgcaaatcacccctaacgaa
ttgtaccctaatgaagtttattgcgtggacccattgggttatattattgggtttacagct
tgtgatgaaccattaacccttgttccaccattgcaaaaatcccaccctaagccagggttg
gtttccaacttgatgtcaaaatctggctctcaatcaagaaatattgaagagaccaaagca
gtgagaagaaacatcgctgtcatgacttcaggtggggattctcaaggtatgaatgctgcc
gttagagctgtcgttagagccacgattttccatggaagcaaggcctttgctgtccaagaa
ggttatgctggtttggtcaaaggtggtcctgaatacattaaggaaatgaaatggcaagac
gtcagaggttttctttcagaagggggtaccaatattggtactgccagatgcatggagttt
aaggaacgttggggtagattgaaaggatgtaaaaacttgattgatgctggaattgacggg
ttgatcgtgtgtggtggtgatggttctttaactggtgctgatttattcagacacgaatgg
ccatcattaattcaagaattgaaagataaaggtgaaatcaccaatgaacaatttgaaaga
cacaaacacttgtacatttgtggtatggtgggttccattgataatgatatggccatgact
gatgctacaattggtggctactctgcattagagagaatttgtcgtgccatcgattacatt
gatgctactgctaactcccattcgcgtgcctttgttgttgaggtcatgggtagacattgt
ggttggttagccttgatggccggtattgctaccagtgctgattatatttttattccagag
aaacctgcctcctcaaaagattggcaagatcaaatgtgcgacattgttggtaaacataga
gctcaaggtaaaagaaagaccattgttattgttgctgaaggtgcaattacctccgatttg
aaaccaatcacatctgacgaagttaaagatgttttggtcgacagattagggttggacacc
agaatcactgtgttgggacatgttcaaagaggtggtactgctgtagcctttgatagaact
ttagccactttgcaaggggttgaagcagtgaaagccattttggaattaactcctgatgtt
ccatctccattaattgccattgacgaaaataagatttgtcgccgtccattggttgaagca
gttagaatcaccaaatccgtggcttcagctatcgaagctaaagattttgaaaaggcaatg
tctttaagggatcacgaattcaaagagcatttggctaatttcatggccatgaacactgcc
aaccatgaaaagccaactttacctcgtgaaaaacgtaagaagattgccattatcaacatc
ggtgctcccgctggtggtatgaattctgctgtttatgctatggccacttactgtatgtct
cgtggtcacaccccatatgctatccacaatgggtttgctggtttatcaagacacgagtca
gtgaaactgattgaatggattgacatcgaagggtggaacagtattggggggtctgaaatt
ggtacgaacagacaaacacctgaagaaactgacattggtatgattgcccattattttgaa
aaataccagtttgacgggttaattattgttggaggttttgaagcatttgtttcgttagag
caattggaaagatcaagagctatgtatccatcgttcagaattcctatggttttaatccct
gccaccatttcaaataatgttcctggtaccgaatattctttaggggctgatacctgtttg
aattcgttaatggaatattgtgacattgtcaagcaatcagcttcagctaccagaggtaca
gcatttattattgatgttcaaggaggtaattccggatacattgccacatttgcctcatta
atcagtggagcacaagcatcctatgttccagaagaaggtatttcattacagcaattggaa
atggatatcaattcattgagagaagcatttgccgtggaacaaggaatgacaaagagtggt
aaattgatcatcaagtcgagtaatgcatccaaagtactaaccccacacacattggctgac
atattcaacgatgaatgtcacggtgactttgacactaagacagctattccgggacacgtc
caacaaggtggattaccttcaccaatagatagaagcagaggtgatagatttgccattaga
gctgttcaatttattgaagaccactgtgatgttttagctccatacagatacgaattggac
ttcccaattgatgacaagaaaatcttaaacacagcggctgtattaggtatcaagtcttca
cgtttgagattcacctctatcagacatttgtttgatttcgaaactgaattgggtagaaga
atgccaaagaccatctactggaatacaattagagatatttctgatcaattagttggaaga
acaagacttgataagccataa

DBGET integrated database retrieval system