KEGG   Candida albicans: CaO19.1392Help
Entry
CaO19.1392        CDS       T00189                                 

Gene name
EPS1
Definition
potential thioredoxin similar to S. cerevisiae EPS1 (YIL005W) protein disulfide isomerase-related protein implicated in protein-ER retention
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CaO19.1392 (EPS1)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CaO19.1392 (EPS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 737 aa AA seqDB search
MKLSILSLLGFLTTAAVGVVGSEINPLEPQIIADQVTNGEHKRQSDDESNSQLKSQSKMD
VPPTLSMKEFDKLTREKLVLVEFFSPYCHHCKEFAPTWKETYIKFVTEYPDLNIEMKQVN
CIESGDLCEREHIDFYPNILLYAPAVDKDGKKTGKSKNIDSFPRNLDRNVENIIKYLREA
TAEFDSGAINLPSSSQLLDVDTMSKIIDGNISTPMFVSFFPATKRQWKSVEHRGRLGFSN
CEDCLPAKQIWDRLSNKILSISDTGHFMCRDHREVCDKLKITSNNEPQFIMFLPESIGAV
RFDYNDYVDVNRMKWWVQKLFQNSQFEVVSARGITEVMEYTKVLSHEPIAQFYPLKSKIT
VVFYYDIDKVTEEDEKILPHLLKTIQESPFNIQLHKGKHKKIEENVLTMGQNLIEYINYD
ENDKYEFDKSIQVLTTLTTKPTILVFKDNSLIADVYQSLSPEDMKTYDKVESFINSIQYP
LYGQLTPQLAPYYFKNNEKYQDHKVVVLFTDLSDLKGTDNQLYKLSLAAHEYHHLKQKYY
FDRFKQSNQVSAATVEKLQEQNQETIDALKELQHVIPELWENDQVLFTFIDLPNAYKQFR
GVKGWRLNPNNYQVGDVVVLSKDNRYYWNKDTQGNKLTNEPKELKKVLMSLLAKDDKLKA
AIVGSPYGGVLGFMDYVHDYGVWGYIGFFLSIYTTGFLVLRLGRRSSRRWLFKRPSSSTP
SSGGGGIIGNNFTPKKD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatctatcttatcattgcttggattcttgacaacagcagcagtaggggtagtg
ggctctgagataaacccacttgaacctcaaataattgcagatcaagtgacaaatggggaa
cacaaacgtcaatctgatgatgaatcaaactctcaacttaaatcccaatcaaagatggat
gtccctcctacattatcaatgaaagaatttgacaaactcactcgagaaaaacttgtactt
gttgaatttttttcgccatattgccatcattgtaaagaatttgcaccaacatggaaggaa
acctatataaaatttgtcactgaataccctgatttgaatattgaaatgaaacaggtcaat
tgtattgaaagtggtgatttatgtgagcgtgagcatatagatttttatcctaacatattg
ttgtatgcccctgccgttgataaagatggcaagaaaactgggaaactgaaaaacattgat
tcatttccaagaaatctcgatagaaatgttgagaatatcatcaaatatttacgagaagcc
acggccgaattcgattcaggtgcaattaatttacccagttcttcacagttgttagatgtt
gacactatgtctaagatcattgatggtaatatttctactccaatgtttgtttcatttttc
ccggccacaaagaggcaatggaaaagtgtagagcatcgaggtaggttggggttctcgaat
tgtgaggattgtttacctgcaaaacaaatatgggatcgattatcaaacaaaattttgtca
atttctgatactggtcatttcatgtgtcgtgatcatagagaagtttgtgacaagttgaag
ataaccagtaacaatgaacctcaatttattatgtttttacctgaatcaataggggccgtt
cgttttgattataacgattacgtcgatgtaaatagaatgaaatggtgggtccagaaatta
ttccaaaattctcaatttgaagttgtttctgctcgtggtattaccgaagtcatggaatac
accaaagtattgtcccatgaacctattgcccaattttatcctttgaaaagtaaaataacc
gtagtgttttattatgatattgataaagtcactgaagaagatgaaaaaatattaccccat
ttactcaaaacaatccaagagtctccgtttaatatccaattacacaagggaaaacataaa
aaaattgaagaaaatgtattgactatgggtcaaaatttaattgaatatataaattatgat
gaaaacgataaatatgaatttgataaatcgatacaagtcttgactacattaacaacaaaa
ccaacaatacttgttttcaaagataactcattaattgccgacgtttatcaaagtctatct
cccgaagatatgaaaacctatgacaaagtagagagttttatcaatagtattcagtatcct
ttgtatggccaattaaccccacaattggctccttattatttcaaaaacaatgaaaagtat
caagaccataaagttgtggtattgtttactgatttactggacttgaagggaacagataat
caattgtacaaattatcgttagcagcacacgaataccaccatttaaagcaaaaatattat
ttcgatagatttaaacaaagtaatcaagtgagtgctgccaccgtggaaaaattacaagag
caaaatcaagaaactattgatgcattaaaagagctacaacatgtaataccagaattgtgg
gagaatgatcaagtcttatttacatttattgatttgcctaatgcatataaacagtttcgt
ggggttaaaggatggagacttaatcctaataattatcaagttggcgatgtggtggtcttg
tctaaagataaccgctactattggaacaaagatacccaggggaacaaattaacaaatgaa
ccaaaagaattgaaaaaggttttgatgtcattattagctaaggatgacaaattgaaagca
gcaatagtgggtagtccctatggaggtgttctagggtttatggattatgtacatgattat
ggtgtttggggatacattggctttttcttgtcaatttacactactggttttcttgttctt
cgtctaggaagaagaagcagtagaagatggttattcaaaaggccgtcatcatcaacacct
agcagtggcggtggtggtattattggtaataattttacgcctaagaaggattaa

DBGET integrated database retrieval system