KEGG   Candida albicans: CAALFM_C209620WAHelp
Entry
CAALFM_C209620WA  CDS       T00189                                 

Gene name
CaO19.1392
Definition
(RefSeq) protein disulfide isomerase
Organism
cal  Candida albicans
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 737 aa AA seqDB search
MKLSILSLLGFLTTAAVGVVGSEINPLEPQIIADQVTNGEHKRQSDDESNSQLKSQSKMD
VPPTLSMKEFDKLTREKLVLVEFFSPYCHHCKEFAPTWKETYIKFVTEYPDLNIEMKQVN
CIESGDLCEREHIDFYPNILLYAPAVDKDGKKTGKSKNIDSFPRNLDRNVENIIKYLREA
TAEFDSGAINLPSSSQLLDVDTMSKIIDGNISTPMFVSFFPATKRQWKSVEHRGRLGFSN
CEDCLPAKQIWDRLSNKILSISDTGHFMCRDHREVCDKLKITSNNEPQFIMFLPESIGAV
RFDYNDYVDVNRMKWWVQKLFQNSQFEVVSARGITEVMEYTKVLSHEPIAQFYPLKSKIT
VVFYYDIDKVTEEDEKILPHLLKTIQESPFNIQLHKGKHKKIEENVLTMGQNLIEYINYD
ENDKYEFDKSIQVLTTLTTKPTILVFKDNSLIADVYQSLSPEDMKTYDKVESFINSIQYP
LYGQLTPQLAPYYFKNNEKYQDHKVVVLFTDLSDLKGTDNQLYKLSLAAHEYHHLKQKYY
FDRFKQSNQVSAATVEKLQEQNQETIDALKELQQVIPELWENDQVLFTFIDLPNAYKQFG
GVKGWRLNPNNYQVGDVVVLSKDNRYYWNKDTQGNKLTNEPKELKKVLMSLLAKDDKLKA
AIVGSPYGGVLGFMDYVHDYGVWGYIGFFLSIYTTGFLVLRLGRRSSRRWLFKRPSSSTP
SSGGGGIIGNNFTPKKD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatctatcttatcattgcttggattcttgacaacagcagcagtaggggtagtg
ggctctgagataaacccacttgaacctcaaataattgcagatcaagtgacaaatggggaa
cacaaacgtcaatctgatgatgaatcaaactctcaacttaaatcccaatcaaagatggat
gtccctcctacattatcaatgaaagaatttgacaaactcactcgagaaaaacttgtactt
gttgaatttttttcgccatattgccatcattgtaaagaatttgcaccaacatggaaggaa
acctatataaaatttgtcactgaataccctgatttgaatattgaaatgaaacaggtcaat
tgtattgaaagtggtgatttatgtgagcgtgagcatatagatttttatcctaacatattg
ttgtatgcccctgccgttgataaagatggcaagaaaactgggaaactgaaaaacattgat
tcatttccaagaaatctcgatagaaatgttgagaatatcatcaaatatttacgagaagcc
acggccgaattcgattcaggtgcaattaatttacccagttcttcacagttgttagatgtt
gacactatgtctaagatcattgatggtaatatttctactccaatgtttgtttcatttttc
ccggccacaaagaggcaatggaaaagtgtagagcatcgaggtaggttggggttctcgaat
tgtgaggattgtttacctgcaaaacaaatatgggatcgattatcaaacaaaattttgtca
atttctgatactggtcatttcatgtgtcgtgatcatagagaagtttgtgacaagttgaag
ataaccagtaacaatgaacctcaatttattatgtttttacctgaatcaataggggccgtt
cgttttgattataacgattacgtcgatgtaaatagaatgaaatggtgggtccagaaatta
ttccaaaattctcaatttgaagttgtttctgctcgtggtattaccgaagtcatggaatac
accaaagtattgtcccatgaacctattgcccaattttatcctttgaaaagtaaaataacc
gtagtgttttattatgatattgataaagtcactgaagaagatgaaaaaatattaccccat
ttactcaaaacaatccaagagtctccgtttaatatccaattacacaagggaaaacataaa
aaaattgaagaaaatgtattgactatgggtcaaaatttaattgaatatataaattatgat
gaaaacgataaatatgaatttgataaatcgatacaagtcttgactacattaacaacaaaa
ccaacaatacttgttttcaaagataactcattaattgccgacgtttatcaaagtctatct
cccgaagatatgaaaacctatgacaaagtagagagttttatcaatagtattcagtatcct
ttgtatggccaattaaccccacaattggctccttattatttcaaaaacaatgaaaagtat
caagaccataaagttgtggtattgtttactgatttactggacttgaagggaacagataat
caattgtacaaattatcgttagcagcacacgaataccaccatttaaagcaaaaatattat
ttcgatagatttaaacaaagtaatcaagtgagtgctgccaccgtggaaaaattacaagag
caaaatcaagaaactattgatgcattaaaagagctacaacaagtaataccagaattgtgg
gagaatgatcaagtcttatttacatttattgatttgcctaatgcatataaacagtttggt
ggggttaaaggatggagacttaatcctaataattatcaagttggcgatgtggtggtcttg
tctaaagataaccgctactattggaacaaagatacccaggggaacaaattaacaaatgaa
ccaaaagaattgaaaaaggttttgatgtcattattagctaaggatgacaaattgaaagca
gcaatagtgggtagtccctatggaggtgttctagggtttatggattatgtacatgattat
ggtgtttggggatacattggctttttcttgtcaatttacactactggttttcttgttctt
cgtctaggaagaagaagcagtagaagatggttattcaaaaggccgtcatcatcaacacct
agcagtggcggtggtggtattattggtaataattttacgcctaagaaggattaa

DBGET integrated database retrieval system