KEGG   Candida albicans: CaO19.14187Help
Entry
CaO19.14187       CDS       T00189                                 

Gene name
HTB1
Definition
one of two closely related histone genes similar to S. cerevisiae HTB1 (YDR224C) and HTB2 (YBL002W) histone H2B
Orthology
K11252  
histone H2B
Organism
cal  Candida albicans
Brite
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CaO19.14187 (HTB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 130 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDGAKKRTKARKETYSSYIYKVLKQTHPDTGISQ
KAMSIMNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSASS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagcagaaaagaaaccagcttccaaagctccagctgaaaagaaaccagct
gctaagaaaaccgcttccaccgatggtgctaaaaagagaaccaaagctagaaaagaaact
tattcctcatatatatataaagttttgaaacaaacacatccagacactggtatctcccaa
aaggccatgtcaattatgaattcgtttgttaacgatattttcgaaagaattgccaccgaa
gcctccaaattagctgcttacaataaaaaatccacaatttccgctagagaaatccaaact
gctgttagattaattttgccaggtgaattggccaaacatgccgtttccgaaggtaccaga
gccgtcacaaaatactcatctgcttctagttag

DBGET integrated database retrieval system