KEGG   Candida albicans: CaO19.1744Help
Entry
CaO19.1744        CDS       T00189                                 

Gene name
HEM4
Definition
similar to S. cerevisiae HEM4 (YOR278W) uroporphyrinogen-III synthase involved in heme biosynthesis; same as cosmid orf Ca38F10.04c
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cal  Candida albicans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cal00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 271 aa AA seqDB search
MTNVILLKNASIPSDPYDIKFSNSNKYKPNFVPLLTHCHKDKSQTLSFLISDEFLNNIPI
FIITSQRAVEMFKECIEELNHDIRQRIYQKIGYTVGPATYKILKSVGFKDVRGGDEAGNG
SKLADLIKQDTIGRENIPMVFFTGVIRKDIIPRKLIDSGYNNFQEFILYQTGDRLDIIDN
FKKVIHGLDKDKDNDDVWIVFFSPQGTKEIVNYLIDRDGNSNQKNWKIASIGPTTRDYLK
DFDLSPHVIAPKPDPEALFETIFQYDKTYAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactaatgttatactactaaagaatgctagtataccttctgatccatatgatataaaa
ttttccaattccaataaatataaaccaaattttgttccattattaactcattgtcataaa
gataaatctcaaacattatcatttttaatcagtgatgaatttttgaataatatcccgatt
tttataatcacttcacaacgagccgttgaaatgtttaaagaatgtattgaagaattaaat
catgatatacgacaacggatatatcaaaaaattggatatacagtggggccggcaacttat
aaaatattaaaatctgtagggtttaaagatgttcgtggaggtgatgaagcaggcaatgga
tcgaaattggccgatttaattaaacaagatactataggaagagaaaatatccccatggtt
ttctttactggtgtgattagaaaagatattatacctaggaaattaattgatagtggatat
aataatttccaagaatttatactttatcaaactggtgatcgattagatattattgataat
ttcaaaaaagtgatacatggtttagataaagataaagataatgatgatgtttggatagta
tttttcagtcctcaaggaacgaaagaaattgttaattatttaattgatcgagatggtaat
tcaaatcaaaaaaattggaaaattgcttctattggtcctacaacgagagattatttaaaa
gattttgatttatcaccacatgtgatagcaccaaaacctgatcctgaagctttatttgaa
actatatttcaatatgataaaacttacgccttgtaa

DBGET integrated database retrieval system