KEGG   Candida albicans: CAALFM_C210050WAHelp
Entry
CAALFM_C210050WA  CDS       T00189                                 

Gene name
CaO19.1777
Definition
(RefSeq) ubiquitin-specific protease
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAALFM_C210050WA (CaO19.1777)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAALFM_C210050WA (CaO19.1777)
Ubiquitin system [BR:cal04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CAALFM_C210050WA (CaO19.1777)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1383 aa AA seqDB search
MITNNNNNSDNNTSSVDPSINVEELPDSKKQLTEDAIDPTQQQEQQPQLMEIDVETNQII
NENGFENHGVASPEVIDMTGDDDYDVDNHNNNNHNHHNNITIEDDDDNVVDDGDDEEDDD
DDDDDDDDDDDEIQIINSEPNSNVVAPKKFTRNFPLANDFNALAAKLMKPIEDYPTKEET
YYVWEIKDWAQLLKEEKVRSPKFKCGGFEWNILLFPRGNSQNNNLSIYMEPHPPVDENDK
PLDENWYVCAQFGLDIWNPAHPDAHLPNQSHHRFTKNETDWGFSSLIELRQLEQVNNPRN
QSSMYAILENNKLNITGFVRVIDDSSTGVLWHSFLDYDSKANTGYVGLNNQGATCYLNSL
LQSYFTTKLFRKLVYEIPTDSKSAGVPLSLQRIFYLLTNSNDPVGTLELTKSFGWDSSDA
FTQHDVQELNRILMDKLETAMKGSKIEGALNDIFVGKMKSYIKCVNVPYESSRVEDFWDI
QLNVKGFQTLKQSFQNYIEIEMLEGENKYQAGEEHGYQDAKKGVVFESFPPVLHLQLKRF
EYDFMVDDLVKIDDFYEFPDKIDLKPYLDEDLPEDVKNQNWNYKLHGVLVHQGSISNGHY
YAMIKPNANDDTWLRFDDDKVWKVNKTQVFQENFGATDLTQEQSQQMTRAEQQEHMVRRV
TSAYMLVYYRESELDKILPSDDNIVNSAIPEHIPKQIQFEIEEREKLEKARQEALYYTTA
KLITSSTFNANLGFDLALDPTNNKFYDESLSGSACDPISLKVRKDSTFTQLVEAVGKTIK
CTNEKLFRLVAVCHRNNHTNRLDAPIGEEFQKSTISNVYSKIFNRKYDEMVFYVEELNKD
IKNVVQLVKNKDNGYIEPKDFTFEQVFSKIDAVGTDIHPNIEFKNTEEYSNYVTIVIKYF
DPVSQEIRGLSHITVAKEDKIDSIIDPIRELLGFNKNITLELYEELSQSKVEKIDSKLTF
EKHELNSGDIITVQIVNPGEINKNGKFKDLKDYYKFLLTRLHVNVRPFKAEIDEEDSDFI
AHEDDEDEDEENKGGETNNGTGYGGKGNGKDTEKDNKATNDEIQLAKNLSKSFDFWISTN
YSYQDLARDIAVKLNCDPLYLKIFILTAQGQRFPLKTSHHLSQLFPKTVSVNQIVEIEYE
ILNIPLKDYENLKAIKIHWLTTLLQYQVFEVLVPKRGTIGDVITKVLHKVNVSESDLPHL
FVWSGRNHKFHEMLKFDRALSTISDDVDLFCGIFPAEVEVLCDHDMYKRFTDKEIDETKL
EESIHEEYLESIRWSKKLNLLPAFHFHKNNNYHHGIPFIFIVFPAETLNDTKERLRKKLR
LGKQAFDKVRLALADNNNRIKYLEDDSLVLFDEVAIKSYSLAIDNVDRNPKRQALFEKGI
SIK
NT seq 4152 nt NT seq  +upstreamnt  +downstreamnt
atgataacaaataataataacaatagtgataataatactagttcggtggatccatcaata
aatgttgaggagttaccggattccaaaaaacaattgactgaagatgcgattgatcctacg
caacaacaagaacaacaaccccaattaatggaaatagatgttgaaaccaatcaaattata
aatgaaaatggatttgaaaaccatggtgtagccagtcctgaagtgattgatatgacaggt
gatgacgactatgatgttgacaaccacaacaataacaatcacaaccaccacaacaatatc
accattgaagatgatgacgataatgtggttgatgatggtgacgacgaggaagacgacgac
gacgacgacgatgatgatgatgatgatgacgatgaaatacaaataattaattcagaacct
aatagcaatgtcgttgctccaaaaaagtttactcgtaatttcccactagctaatgatttt
aacgctcttgcagccaaactaatgaaacccattgaagactatcccacaaaagaagaaacc
tattatgtttgggaaataaaggattgggcacaacttttaaaggaagaaaaagtccgatca
ccaaaatttaaatgtgggggatttgaatggaatattttattatttcctcgtggtaactca
caaaataataatctatcaatatatatggaacctcatccaccagttgatgaaaatgataaa
ccattagatgaaaattggtatgtttgtgctcaatttggattggatatttggaatccagct
cacccagatgctcatttaccaaatcaaagtcatcatcgatttactaaaaatgaaactgat
tgggggtttagttcattaatagaattgagacaattagaacaagtcaataatccaagaaat
caatcgtcaatgtatgccattttggaaaataataaattaaatatcactgggtttgttcga
gttatagatgattcttctaccggggtattatggcattcatttttagattatgattctaag
gcaaatactggatacgttggtttaaataatcaaggagctacatgttatttgaattcatta
ttacaaagttatttcacaactaaattatttagaaaattagtgtacgaaatccccaccgat
ctgaaatctgcaggagtacctttgtcattacaaagaattttctatttgttgaccaattca
aatgatccggtggggacgttagaattgacaaaatcatttggttgggactcgtcagatgca
ttcacccaacatgatgtacaagaattgaatcgtattttgatggataaattagaaactgct
atgaaagggtcgaaaattgaaggtgcattaaacgatatatttgtggggaaaatgaaatct
tatattaaatgtgtaaatgttccctatgaatcgtcacgggtggaagatttttgggacatt
caattgaatgttaaaggtttccaaactctcaaacaatcatttcaaaattatattgaaatt
gaaatgttggaaggtgaaaataaataccaagcaggtgaagaacatgggtatcaagatgcc
aaaaagggggttgtatttgaatcattcccaccagtattgcatttacaattgaaacgtttc
gaatatgattttatggttgatgatttagttaaaattgatgatttttatgaattccccgat
aaaattgatttgaaaccataccttgatgaagatttaccagaagatgtgaaaaaccaaaat
tggaattataaattgcatggtgtgttggtgcatcaaggtagtatttccaatggtcattat
tatgccatgatcaaaccaaatgctaatgatgatacttggttaagattcgatgacgataaa
gtttggaaagttaataaaactcaagttttccaagagaattttggtgctactgatttgaca
caagaacaatcacaacaaatgacaagagctgaacaacaagaacatatggtgagaagagta
acgtcggcatatatgttggtttattatcgtgaatctgaattagacaaaattttaccaagt
gatgataacattgtcaattctgccattcctgaacatatccccaaacaaattcaatttgaa
attgaggaacgtgaaaaattggaaaaggcaagacaagaagccttgtattatacaactgcc
aaattgataacttcatccacattcaatgccaatcttggatttgatcttgccttggatcca
acgaataataaattttatgatgaatccttgagtggtagtgcatgtgaccctatatcgttg
aaagtaagaaaagatagtacatttactcaattggttgaagcagtgggcaaaacaattaaa
tgtactaatgagaaattatttagattagttgccgtttgtcatagaaataaccataccaat
agattggatgctcccattggtgaagaatttcaaaaatcaacgataagtaatgtttattcg
aaaatatttaatcgaaaatatgatgaaatggttttttatgttgaggaattgaataaagac
attaagaatgttgttcaattggtgaaaaataaggataatggttacattgaacctaaagat
tttacatttgaacaagtgtttagtaaaattgatgctgttggtactgatattcatccgaat
attgaatttaaaaataccgaagagtattctaattatgttactatagttatcaaatatttt
gatcctgtatcacaagaaattagaggattatcacatattactgtggccaaagaagataag
attgattcaattatagacccaatccgtgaattacttggatttaacaaaaatatcacttta
gaattgtatgaagaattatcacaatcaaaagttgaaaagattgattctaaattaactttt
gaaaaacatgaattgaatagtggtgatatcattactgttcaaattgtcaatccaggtgaa
atcaataaaaatggtaaatttaaagatttgaaagactattataaatttttgttaactaga
ttgcatgttaatgtcagaccatttaaggcagaaattgatgaagaagattctgatttcata
gctcatgaagacgatgaagatgaagatgaagaaaataaaggaggtgaaactaacaatggc
actggttatggtggtaagggaaatggaaaagatactgaaaaagataataaagctacaaat
gatgaaattcaattggctaaaaatttgagtaaaagttttgatttttggatttcgacaaat
tatagttatcaagatttagcaagagatattgctgttaaattaaattgtgatcctttatat
ttaaaaatatttatattaactgctcaaggtcaacgattcccattaaagacaagtcatcat
ttatctcaattattccccaagacggtatcagtcaatcaaattgttgaaattgaatatgaa
atacttaatattccattaaaagattatgagaatttgaaagccattaaaatccattggtta
acgacattattacaatatcaagtatttgaagttttagttcctaaacgtggaactataggt
gatgttattactaaagttttacacaaggttaatgtatcggaatcggatttacctcattta
tttgtttggtcaggacgaaatcataaatttcatgagatgcttaaatttgatagggcatta
agtacaatttctgatgatgttgatttattttgtgggattttcccagctgaagttgaagta
ttatgtgatcatgatatgtataaaagatttactgataaagaaattgatgaaacaaaattg
gaagaatcaattcatgaagaatatttagaaagtattagatggagtaaaaaattaaatctt
ttaccagcatttcattttcataaaaataataattatcatcatggaattccatttattttt
atagttttcccggctgaaacgttaaatgatacgaaagaacgattaaggaaaaaattaaga
ttaggaaaacaagcatttgataaagttagacttgcattagctgataataataatagaatc
aaatatttggaagatgattcattggtattgtttgatgaagttgccattaaactgtatagt
ttggctattgataatgttgatagaaatcctaaacgtcaagcattatttgaaaaagggatt
tccatcaaataa

DBGET integrated database retrieval system