KEGG   Candida albicans: CaO19.1801Help
Entry
CaO19.1801        CDS       T00189                                 

Gene name
CBR1
Definition
cytochrome b reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cal  Candida albicans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cal00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 294 aa AA seqDB search
MSETTTVPPIETVSEPNPFIVFATVATIISAFIGYYFLQQSKKHTPVLKPDEFQKFPLIE
KIRVSHNSAIYRFGLPKSTDRLGLPIGQHISIGATIDGKEVVRSYTPISTDDQLGHFDLL
IKTYENGNISRHVAGKNVGEHIEIRGPKGFFTYTPNMVKSFGMIAGGTGIAPMYQIITAI
LKNPEDKTKIHLVYANVTESDILLKEELDNFAARHPDRLKIHYVLNEAPANWQGSVGFVT
PEIIDTHLPKASNDTNLLLCGPPPMVSAMKKAAVELGFQKAKPVSKLGDQVFVF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaactactactgttcctcctattgaaactgtatctgaaccaaatccatttatt
gtttttgctacggtcgctactattattagtgcgtttatcggatactatttccttcaacaa
tcgaaaaagcataccccagttttaaaaccagatgaatttcaaaaattccctcttattgaa
aaaattagagtcagtcataattcagcaatttatagatttggtttaccaaaactgactgat
agattaggattaccaattggtcaacatatttctattggtgctactattgatggtaaagaa
gttgttcgttcatatactccaatttctaccgatgatcaattgggtcattttgatttatta
attaaaacttatgaaaatggtaatatttctagacacgttgctgggaaaaatgttggtgaa
cacattgaaattagaggtccaaaagggtttttcacttatactccaaatatggttaaaagt
tttggtatgattgctggtggtactggtattgcaccaatgtatcaaatcattactgctatt
ttgaaaaaccctgaagataaaactaaaattcatttggtttatgctaatgttactgaatca
gatattttattaaaagaagaattggacaattttgctgctagacatccagatagattaaag
atccattatgttttgaatgaagccccagctaattggcaaggttcagttggatttgttact
ccagaaattatagacactcatttaccaaaggcttcaaatgacactaacttgttattatgt
ggtccaccaccaatggttagtgctatgaaaaaagctgctgttgaattaggatttcaaaaa
gctaaaccagtttctaaattgggtgatcaagtgtttgtcttttaa

DBGET integrated database retrieval system