KEGG   Candida albicans: CaO19.1833Help
Entry
CaO19.1833        CDS       T00189                                 

Gene name
CBF5
Definition
likely pseudouridylate synthase similar to S. cerevisiae box H/ACA snoRNP component CBF5 (YLR175W) involved in nucleolar RNA modification
Orthology
K11131  
H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
cal  Candida albicans
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    CaO19.1833 (CBF5)
Enzymes [BR:cal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.-  
     CaO19.1833 (CBF5)
DNA replication proteins [BR:cal03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     CaO19.1833 (CBF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 479 aa AA seqDB search
MSSKEDYIIKPESVSPSNDTSQWPLLLKNYDKLLVRSGHYTPIPAGSAPLNRDIKSYVSS
GVINLDKPSNPSSHEVVAWIKRILRVEKTGHSGTLDPKVTGCLIVCIDRATRLVKSQQGA
GKEYVCIVRLHEQLKDDKELNRALENLTGALFQRPPLISAVKRQLRVRTVYDSKLIEFDN
KRGLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRVRSGAMSESDNLVTLHDVLDA
QYVYDNTRDESYLRKIIQPLESLLVGYKRVVVKDSAVNSVCYGAKLMIPGLLRYEEGIEL
YDEVVLMTTKGEAIAIGIAQMSTVDLQSCDHGIVAKVKRCIMERDTYPRRWGLGPIAQKK
KQMKADGKLDKYGRVNENTPENWKKDYKDLDEQPAPPIPESKLVAPEPQLPKKKSLIEEV
EVDIDVEDKSEKKEKKDKKEKKEKKDKKEKKEKKDKKEKKRKAEDDSSKSEKKKKSKKD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaaagaagattatatcattaagccagaatcggtatcaccatccaatgataca
tctcaatggccattattattgaaaaattatgataaattattagttagatcaggacattat
actcctattcctgctggttctgctccattgaatcgtgatattaaatcatatgtatcatca
ggggttataaatttagataaaccttcgaatccatcatctcatgaagttgttgcttggatt
aaaagaattttacgagtagaaaaaactggtcattccggaactttagatcctaaagtcact
ggttgtttaattgtttgtattgatagagccactagattggttaaatctcaacaaggtgct
ggtaaagaatatgtttgtattgttagattacatgaacaattaaaagatgataaagaatta
aatcgtgctttagaaaatttaactggggcattatttcaaagacctccattgatttctgcc
gttaaaagacaattgagagttagaactgtttatgattctaaattgattgaatttgataat
aaacgaggattaggagtattttgggcatcttgtgaagctggtacttatatgagaacttta
tgtgttcatttaggtatgttattgggtgttggtggccacatgcaagaattacgtcgtgtt
agatcgggtgctatgagtgaatcagataatttagtcacgttacatgatgttttagatgct
caatatgtttatgataatactagagatgaatcttatttaagaaaaatcattcaaccttta
gaaagtttattagttggctataaaagagttgttgttaaagattctgctgtaaattctgta
tgttatggtgctaaattaatgattccaggtttattaagatatgaagaaggaattgaatta
tacgatgaagttgttttaatgactactaaaggtgaagccattgctattggtattgctcaa
atgtcaaccgttgatttacaatcttgtgatcatggaattgttgctaaagttaaaagatgt
attatggaaagagatacttatccaagaagatgggggttaggtccaattgctcaaaagaaa
aaacaaatgaaagctgatggtaaattagataaatatggtagagtaaatgaaaatactcca
gaaaattggaaaaaagattataaagatttagatgaacaacctgctcctccaattcctgaa
tctaaattagttgctccagaacctcaattaccaaagaaaaaatctttgattgaagaagtt
gaagttgatattgatgttgaagataagagtgaaaagaaagaaaagaaggataaaaaggaa
aagaaggaaaagaaagataaaaaagagaaaaaggaaaagaaggataaaaaagagaaaaag
agaaaagctgaagatgatagttccaagagtgaaaagaaaaagaaatctaaaaaggattaa

DBGET integrated database retrieval system