KEGG   Candida albicans: CaO19.1946Help
Entry
CaO19.1946        CDS       T00189                                 

Definition
potential aldose epimerase; similar to S. cerevisiae YMR099c
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cal00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 299 aa AA seqDB search
MPVEELEDRVIITDPNDSTNRATILKFGATVVSWKNNNQEKLWLSEGAHLDGSKAVRGGI
PLVFPVFGKQKDSNHPTFKLPQHGFARNSTWEFLGQTQESPITVQFGLGPENVDPETLKL
WNYDFTLILTVSLTKDKLVTSIDVENTGKEAFEFNWLFHTYYRIHDITDTLVTNLIDQQC
YDQLIGESYIEKAPVISFHEEFDRIYSKVSLEKSIQVVDKGQVLFNLHRKNLPDSVVWNP
WTKKAEGMADFQPKSGFHQMVCVEPGHVNSMVSLPAGGKWSGGQEITIGGEIKVQANIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgaagagcttgaagaccgtgttatcattactgatccaaatgactcaactaac
agagccaccattttgaaatttggtgctactgttgtttcttggaaaaacaataatcaagaa
aaattgtggttatcagaaggtgctcatttagatggaagtaaagccgttagaggtggtatc
ccattagttttcccagttttcggtaaacaaaaagattcaaatcatccaactttcaaatta
cctcaacatggatttgctcgtaattcaacttgggaattcttgggacaaactcaagaaagt
ccaattacggttcaatttggattaggtccagaaaatgttgatccagaaactttgaaatta
tggaattatgatttcactttgattttaactgttagtttgactaaagataaattggttact
tcaattgacgtggaaaacactggtaaagaagcatttgaatttaattggttgttccataca
tattatagaatccatgacatcaccgatacattagttaccaatttaattgaccaacaatgt
tacgatcaattgattggtgaatcatatatcgaaaaggcaccagttatcagtttccatgaa
gaatttgatagaatttattcaaaagtcagtttggaaaaatccattcaagtcgttgataaa
ggtcaagttcttttcaatcttcatagaaaaaacttgcctgattccgttgtatggaatcca
tggactaagaaagctgaaggtatggctgatttccaaccaaaatcagggtttcatcaaatg
gtctgtgttgagccaggtcatgttaactcaatggtctctttaccagctggtgggaaatgg
tcaggtggtcaagaaatcactattggtggtgagattaaagttcaagctaatatttattag

DBGET integrated database retrieval system