KEGG   Candida albicans: CaO19.2026Help
Entry
CaO19.2026        CDS       T00189                                 

Gene name
UBP9
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 700 aa AA seqDB search
MGNSETDNLLFGDGSDKIFGMENFGNTCYCNSILQCLYYTESFRLKLIQHNQTKHDPKLI
VTGVKPHSFTSKYEQLVQKKLREQGGKSASSNSNTATEERPKQGSRKGSIFGIKFNNSVN
TSTTTVPVAIDDSKKLYMKYIDKAKDCEALSLEQRIKISKSPEFQKLDILVTRPSINQTA
KKPVDDDNRNDYSQSSSMLLNDQPQQTIQEGSISTTSSAIIVGIPHPESNLNTPINPFNS
DPSGDQRKRSALINGPIINLDTSLQLPSEQQEDTALLYALKDLFESMVENKSTIGVVSPT
YFIQKLKEKNFLFRQNNMHHDAHEFFNYLTNEIIESLNKEGFTNDKNWCSDIFRGLITNE
TKCLSCEKITSKQELFLDLSIDIPPGESAFSLSYALNNFSKSETLTHQNKFYCNTCSSLQ
EAVKTIKLKKLPEVLVINLKRFKYDEQMDKMVKLFDSINYPFKLRLFNTTDDESLTDLLY
ELYALVIHIGGGPMHGHYVSLCKIKAGLWLLFDDETVELVEDSYVMRFFGNGPGLASAYI
LFYRQAKYDPEFGFNPEDIYNGNDDYSFKQTEDESSTFATSVNNDYLDTKSEASSIASFN
VNEATKKTNVFKNFKFDKDDKPPAPISRSNSMNANLAPGAPVKEVKEKKSWVGNLKRRNT
ETSNSGNIPPMERKPSTSSTTSGNGNTTERRRSIFGFKRK
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggggaacagtgaaaccgacaatctattattcggtgatggatcagataaaatatttggg
atggagaattttggaaacacatgctattgcaattctatactacaatgtttatactacacg
gaaagtttcagattgaaactaatccaacataaccaaacaaagcatgatcctaaacttatt
gttacaggagtcaaaccccatagtttcacaagcaaatacgaacaacttgtacaaaagaaa
ctacgagaacaaggagggaagctggcatcactgaattcaaacacggctactgaagaaaga
cccaaacaaggtagtagaaaaggatccatttttggtattaaatttaacaattcagtcaat
acctcaactacaacggttcctgtagctattgatgattcaaaaaaactatatatgaaatat
atcgacaaagccaaagactgtgaggctctatcgttggaacaacgcataaaaataagcaaa
tctccagaatttcaaaagttagatatcttggtaacaaggccgtcaatcaatcaaacagct
aaaaagcctgttgacgacgacaatagaaatgattattcacaaagctcatctatgctactc
aatgatcaaccacaacaaactatacaagaagggtctattagcactacttctagtgctata
atagttggaataccacatcccgaatctaacttgaacacaccaattaacccattcaattcg
gatcccagtggcgatcagagaaagagatcagccttgatcaatggaccaattatcaaccta
gatacatcattgcaacttcccagcgagcaacaagaagatacagccttgctatatgcgttg
aaggatttatttgaaagtatggttgaaaacaaatctaccattggagtagtatcaccaacc
tactttattcagaaactcaaagaaaagaactttttgtttcgtcagaacaatatgcatcat
gatgctcatgagtttttcaattatttgaccaatgaaatcattgaaagtttgaacaaagag
ggtttcactaacgataaaaactggtgcagtgatattttccgaggtctaatcaccaatgaa
accaaatgcttatcttgtgaaaagatcacatctaaacaggaactatttctagatttgtcc
attgatataccaccaggagaaagtgctttttcattaagttatgcattaaataatttctca
aagtcagaaactttaactcatcagaataagttttattgcaacacctgttcttccttacaa
gaggcagtgaaaacaataaaactcaaaaaattgcccgaagtgcttgttatcaatttgaaa
agattcaagtacgatgaacaaatggacaagatggttaaactttttgattccataaattac
cctttcaagttgcgattgtttaacactactgatgatgaatcgttgacggatttgttgtat
gaattgtatgcattagttattcacattggtggtggaccgatgcatggacattatgtttcg
ttatgcaaaatcaaagctggattatggttattatttgatgacgaaactgttgaattggtg
gaggattcatatgtaatgaggttttttggtaatggacccggtctagcaagtgcttacatt
ttattctacaggcaggcgaaatacgatcctgaatttggttttaatcctgaggatatttac
aatggcaacgacgattactctttcaagcaaacagaggacgaatcaagcacatttgcaact
tcggttaacaatgactatcttgataccaaatcagaagcttcttccattgcctctttcaat
gtgaatgaggcgactaaaaagacaaacgtattcaaaaatttcaaatttgacaaggatgac
aaacccccagctccaatttctcgtagcaatagtatgaatgctaaccttgctccaggtgct
cccgttaaagaggttaaagagaagaaatcttgggttggtaatttgaagagaaggaatacc
gagaccagtaatagtggaaatataccaccgatggaaagaaaaccttccacaagtagcaca
acatctggaaatggtaacaccactgaaagaagaagaagtatatttgggtttaaaaggaag
tag

DBGET integrated database retrieval system