KEGG   Candida albicans: CaO19.209Help
Entry
CaO19.209         CDS       T00189                                 

Gene name
DFG10
Definition
possible transmembrane steroid 5-alpha-reductase similar to S. cerevisiae DFG10 (YIL049W)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CaO19.209 (DFG10)
    1.3.1.94  polyprenol reductase
     CaO19.209 (DFG10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 282 aa AA seqDB search
MAIYDSQLTVVALYSLIIIAIYSAKFITPLNELLQYGKTVSQDVREHARLENNLIKQTIG
FISKYFVVPKAWFVHFYITLFALSSLIFLASFNEPISSDPEKFKNLILIHRLLWVQGIRR
LTECLTITNFSKTSKMNVSHYVVGLSHYILVTWATYLGLSTYGSHQVPNNYTVFDIVLII
GFAICSLLQFQAHYHLSTLVKYTLPDFKFVSSPHYFYEILIYTILLSFAIKDGFDMVSVT
FFTAWLFVISNLSISSLETFSYYQKKYKEEFKLKWAVLPGIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggctatttatgacagtcagcttacagtggttgcactatatctgctaattattattgca
atatattcagcaaagtttattacaccattgaacgagttgttacagtatgggaaaactgta
tctcaagatgtaagggaacatgctcggttagagaacaatcttatcaaacaaacaattggg
tttatatccaaatattttgtggttcccaaggcatggtttgttcatttttatatcactttg
tttgctttatcttctttgatttttttggcgtcattcaatgaaccaatatcgtccgatcct
gaaaaattcaaaaacttgattttgattcatcgattactatgggtccaaggaataagaagg
ttaactgaatgtctcactattaccaatttttccaaaacctcaaagatgaacgtgagccat
tatgtagtaggattaagtcattatatcttagtgacgtgggctacctatttggggctaagt
acatatggatcacatcaagtccctaacaactatactgtatttgatattgtattaatcata
gggtttgcaatttgctctttgctacaattccaagctcactatcacttgtcaaccttagtg
aaatacactttgccagacttcaaatttgtttcatcaccccattatttctacgagatattg
atttacacgatcttgctcagttttgcaattaaagatggtttcgatatggtttcagtaaca
ttcttcactgcctggttatttgtcataagtaatctaagcataagctctcttgaaacattt
agctattaccagaaaaagtacaaagaagaattcaagttgaagtgggctgtattgccaggt
atattgtag

DBGET integrated database retrieval system