KEGG   Candida albicans: CaO19.2114Help
Entry
CaO19.2114        CDS       T00189                                 

Gene name
URO99
Definition
Urate Oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cal  Candida albicans
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cal00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 303 aa AA seqDB search
MQSELYSSTYGKGNVKFLKVKKDPSNPTVQDVLEANVQVLLRGKFDESYTKADNSSIVPT
DTVKNTILVEAKTTDVWPIERFAAHLAKHFTTKYGHVDGIEVTIIQAKWSKIKLEGKEHA
HSFKHEGPETRRTYLNYDKHTKKLQLSSSIKDLTVLKSTGSMFYGYNVCDYTTLQPTKDR
ILSTDVDASWTFDPTQIATLDDILSQPKLFDTTYNTARDVTLELFCKENSPSVQSTMYNM
SHKILETVKQVGTVSYVLPNKHYILFNLEWKGIKDNKDLFYPAPDPNGLIKSTVGRKGDK
AKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccgaattatactcctcaacctacggtaaaggtaatgtcaaatttttaaaggtc
aaaaaagatccatcaaacccaactgtgcaagatgttcttgaagctaatgtccaggttttg
ttgagaggtaaatttgatgaatcgtacaccaaagccgacaactcgtcgattgttcctact
gatacggtcaaaaacacgattttggttgaagccaaaaccactgatgtttggccaattgaa
aggtttgctgctcatttagctaaacatttcaccactaaatacggacatgttgatgggatt
gaagttaccattattcaagccaaatggtcaaagattaagttagaaggtaaggaacatgct
cattcattcaagcacgaagggccagaaactagacgtacttatttgaactacgacaagcac
accaagaaattacaattgtcgtcctcaatcaaggacttgacggtgttgaaatcaactggg
tccatgttttatgggtataatgtgtgtgactacaccactttgcaacctaccaaagataga
atcttgtcgactgatgttgatgcttcgtggacatttgatccaacacagatcgctacttta
gacgacatattatcgcaaccaaaattgtttgacaccacatataatactgctagagatgtc
acattagaattgttctgtaaagaaaattctccttcggtccaatccaccatgtacaacatg
tctcacaagattttggaaaccgtaaagcaagttggtactgttagctatgttttaccaaat
aaacattacatcttgttcaatttggaatggaagggcattaaagacaacaaagacttgttc
tacccagcacctgatccaaatggtttgattaaaagtactgttggtagaaaaggtgacaaa
gccaagttttag

DBGET integrated database retrieval system