KEGG   Candida albicans: CaO19.2267Help
Entry
CaO19.2267        CDS       T00189                                 

Gene name
RFA2
Definition
subunit 2 of replication factor RF-A
Orthology
K10739  
replication factor A2
Organism
cal  Candida albicans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:cal03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:cal03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cal03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cal03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 272 aa AA seqDB search
MSDFEYDNNNTGAFGNISQGGFNTEHAGSSQRQTTTQVRQSLTPVTIKQINDATQPVPDG
EFKVNNVELNMISFVGVVRNVENTNASIAVTIEDGTGSIDVRKWVDETISSAEEDFEKYN
EMKGKYVYVGGSLKQFNNRKTVQNASISLITDSNQIVYHHLSAIEHHLKAQGITAADAAS
AGAGQATNSTASAGSGLFMDNPTSLSKDTGSLTDQVIAVLKEASRTMPDGVPVDYVAEKL
SITKEESQFQLLKLNDEGKAYAGYDDNSYLVI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgaatacgataataacaatactggagcattcggcaatatatcccaaggt
ggtttcaatactgaacatgctggatcgtctcagcgtcaaacaacaacccaagttagacaa
agtttgacacctgtaaccatcaaacaaattaatgatgcaacacaaccagtgccagatggc
gagttcaaagtaaataatgtcgaattaaatatgatttcatttgttggtgttgtacgcaat
gttgaaaatacgaatgcatctattgcagtaactattgaagatggcactgggtctattgat
gttcgtaaatgggtggatgagactatcagctcggccgaagaggactttgaaaagtataat
gagatgaaaggtaagtatgtttatgttggtgggtcattgaaacagttcaacaatcgtaaa
actgtccagaatgcttctatttctttaataactgacagcaatcaaattgtatatcaccat
ttgagtgcaattgaacatcatttgaaagctcaaggcattacagcagctgatgctgctagt
gctggtgctggacaagcaacaaattccactgccagtgctggtagtggattgtttatggat
aatccaactagtctctcgaaagatacaggatcacttacggatcaagtgatagccgtattg
aaagaagccagcagaaccatgccagatggtgtcccagttgactacgttgctgaaaaattg
agtattactaaagaggaaagtcagttccaacttttaaaattgaatgatgaaggtaaagct
tatgctggttatgatgacaacagttatcttgtgatttga

DBGET integrated database retrieval system