KEGG   Candida albicans: CaO19.2306Help
Entry
CaO19.2306        CDS       T00189                                 

Definition
similar to MMSAB operon regulatory protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cal  Candida albicans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cal00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 178 aa AA seqDB search
MVEFYFHDNKDTLENFTEDHNSGEPVSFDQLAEIGVIYKYITTQEELDALATEREYKNRD
VVTLNLPAFNNDIDAYNAKMQQFYKEHYHEDEEIRYIAEGEGYFDVRDKQDRWIRAKLSP
YDLLILPAGIYHRFTLTNAAKHVKAVRLFKDEPKWEAINRDTGKNTEARELYAKTIAV
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaattttattttcatgataacaaagatacacttgaaaattttactgaagatcac
aattcaggagaaccagttagttttgatcaactagctgaaattggtgttatttacaagtac
attactacccaggaagaattagacgcattggctactgaaagagaatacaagaatagagat
gttgttactttaaacttaccagccttcaataatgatattgatgcttataatgccaaaatg
caacagttttacaaagaacattatcatgaagatgaggaaattagatatattgctgaaggt
gaaggttattttgatgttagagataaacaagatcgttggattagagctaaattatcacct
tacgatttgttgattttaccagcaggaatttatcatcgttttacattgactaatgctgca
aaacacgtcaaggcagttagattatttaaagatgaacctaaatgggaagctatcaataga
gacacaggaaaaaataccgaagctcgtgaactctatgctaagactattgcagtatag

DBGET integrated database retrieval system