KEGG   Candida albicans: CaO19.2516Help
Entry
CaO19.2516        CDS       T00189                                 

Definition
similar to N terminus of S. pombe SPAC17H9.14c putative protein disulfide isomerase (EC 5.3.4.1); one of two genes similar to S. cerevisiae PDI1 (YCL043C)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CaO19.2516
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CaO19.2516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 221 aa AA seqDB search
MMKLLSIITTVLYFFTFLVSSYTTSNIIQANDNNLQSLIKTRGKFSFVDFYADWCRHCKK
ISPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTLLFFYDDGRKIEFDGIR
DLTSLSNFIQQLSGIRLNESKSTDNNEEEEEEKKEKKESSSSGSSSNVNDADEETNKLIE
LTPENFDEKVSQSPISIVSFGASWCKYCQELDTALDKLANE
NT seq 664 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttttatcaataataacaacagtgttatatttcttcacattcttggtatca
tcatatacaacatcaaatatcattcaagcaaatgataataatttacaatcacttataaaa
actcgagggaaattttcatttgttgatttttatgctgattggtgtcgtcattgtaaaaaa
atttcacccattatagatgaattaagtgaattatttattgattatcctgagattcaaata
attaaaattaatggtgataaagatgggaaaaaaatgagtaaaaaatatgttgatattgga
tatccgacattattatttttttatgatgatgggaggaaaattgaatttgatggaattaga
gatttgactagtttaagtaattttattcaacaattaagtgggattagattaaatgaaagt
aaatcaactgataacaatgaggaggaggaggaggagaagaaggagaagaaagaaagtagt
agtagtggtagtagtagtaatgtaaacgatgcagatgaggaaacgaacaaattgattgaa
ttgactccggaaaattttgatgaaaaagtatcacaatcaccaatatctattgtatcattt
ggagcatcatggtgtaaatattgtcaagaattagatacagcattagataaattagccaat
gaag

DBGET integrated database retrieval system