KEGG   Candida albicans: CAALFM_C301140WAHelp
Entry
CAALFM_C301140WA  CDS       T00189                                 

Gene name
CaO19.2516
Definition
(RefSeq) hypothetical protein
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CAALFM_C301140WA (CaO19.2516)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CAALFM_C301140WA (CaO19.2516)
Chaperones and folding catalysts [BR:cal03110]
 Protein folding catalysts
  Protein disulfide isomerase
   CAALFM_C301140WA (CaO19.2516)
Membrane trafficking [BR:cal04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    CAALFM_C301140WA (CaO19.2516)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 238 aa AA seqDB search
MMKLLSIITTVLYFFTFLVSSYTTSNIIQANDNNLQSLIKTRGKFSFVDFYADWCRHCKK
ISPIIDELSELFIDYPEIQIIKINGDKDGKKMSKKYVDIGYPTLLFFYDDGRKIEFDGIR
DLTSLSNFIQQLSGIRLNESKSTDNNEEEEEEKKKKKESSSSGSSSNVNDADEETNKLIE
LTPENFDEKVSQSPISIVSFGASWCKYCQELDTALDKLANEVYIRDSNNNNNNNKKKL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacttttatcaataataacaacagtgttatatttcttcacattcttggtatca
tcatatacaacatcaaatatcattcaagcaaatgataataatttacaatcacttataaaa
actcgagggaaattttcatttgttgatttttatgctgattggtgtcgtcattgtaaaaaa
atttcacccattatagatgaattaagtgaattatttattgattatcctgagattcaaata
attaaaattaatggtgataaagatgggaaaaaaatgagtaaaaaatatgttgatattgga
tatccgacattattatttttttatgatgatgggaggaaaattgaatttgatggaattaga
gatttgactagtttaagtaattttattcaacaattaagtgggattagattaaatgaaagt
aaatcaactgataacaatgaggaggaggaggaggagaagaaaaagaagaaagaaagtagt
agtagtggtagtagtagtaatgtaaacgatgcagatgaggaaacgaacaaattgattgaa
ttgactccggaaaattttgatgaaaaagtatcacaatcaccaatatctattgtatcattt
ggagcatcatggtgtaaatattgtcaagaattagatacagcattagataaattagccaat
gaagtatatatacgtgatagtaacaacaacaacaacaacaacaaaaaaaaattatga

DBGET integrated database retrieval system