KEGG   Candida albicans: CaO19.2540Help
Entry
CaO19.2540        CDS       T00189                                 

Gene name
SAS3
Definition
(RefSeq) potential histone acetyltransferase similar to S. cerevisiae SAS3 (YBL052C) catalytic subunit of the HAT complex NuA3
  KO
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CaO19.2540 (SAS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
R
AA seq 805 aa AA seqDB search
MVSHLLNQLKITNNHIYSNIVPQDLDKRTIRAKPTNDYSLKSMIKNNTHQKSTIPITNTT
KIKSVHDDSNSNIKRVKRSFKHNNIFVKLTKKKCIVVINYDKTKLSTITRSKLDTVPLLP
NSTSFTSENQNQNQVDTSILSEIQLPYKGILKYPDCIINDTDPTKLDTERFNKYLDEGIK
LRNKTTCHLETETETETETETKTEIETELQSQVFSNLLHPILNESNQSTESTPVPNYSNL
NKSKINRIVLRDFEINTWYIAPYPEEYSQCEVLYICEYCLKYMNSPMSYRRHQLKNCNFS
NNHPPGLEIYRDQKSKISIWEVDGRKNINYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLT
EIDEKNPSNYHFVGYFSKEKLNSSDYNVSCILTLPIYQRKGYGNLLIDFSYLLSRNEFKY
GTPEKPLSDLGLLSYRNYWKVTIAYKLKQIYDKYFSCNANGDGDSVSDNARLSLSIDTLC
KLTGMIPSDVIVGLEQLDSLARNPITHNYAIVINLDKINTEIAKWEKKSYTKLVYEKLLW
KPMLFGPSGGINSAPSIQPPQPQSTSVTTTTMSAREGTTNSHPKPVIPQNSISLITNFLK
DDINNPYTFEEEGFKEIEAHRETENEEIKNASLVEYVTCYPGIVVNNHFVNGGGGSGESN
GSNDQIKGHKKMLKKRKRIIDDDDDDDDDDDDDDDEIEKIFEIDEIPSNDENEPDFEDDS
DDVDDFMDDDEEEVVEIKDNDSDEDVSEDIIEILDDDDQEEEDWRRTWKRRVPSPPKRKT
VNVLTGNNNKPRGRGRPRGTFKLKA
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcacctactaaatcaattaaaaattaccaataaccatatttattccaatata
gtgccgcaagatttggataaaagaaccattcgagccaagcccaccaatgattattctttg
aaaagtatgataaaaaataatactcatcaaaaactgactataccaataacaaacaccacc
aaaataaaatctgttcatgatgatagcaacagcaatatcaaaagagtgaagaggagtttc
aaacataacaatatttttgtcaaattaacgaaaaagaaatgtattgttgttattaattat
gacaaaacaaaactatcgacaataaccagatcaaagttagatactgtaccattactaccc
aatagtacatcatttacactggaaaaccaaaaccaaaatcaggtagatacatctatattg
tcagaaatacagttaccttataaaggtatattaaagtacccagattgtattatcaatgac
actgaccccacaaaactagatacagaaaggtttaacaaatatctcgatgaagggataaaa
ttgcgaaataaaaccacttgccatttggagacagagacagagacagagacagagacagag
acaaagacagagatagagacagaattacagtcacaagttttttctaatttactccatcca
atactaaatgaatcaaatcaaagtacagaatctactccggtgcctaattattcaaattta
aacaaatcgaaaataaatcgaatagtactaagagactttgaaatcaatacctggtatatt
gctccatatccagaagaatattcacaatgtgaagtattatacatttgtgaatattgtctc
aaatatatgaattcaccaatgtcttaccgacgacatcaattgaaaaattgtaatttttca
aacaatcatcctccaggattagaaatttatcgagatcaaaaaagtaaaattctgatttgg
gaagttgatggaaggaaaaacattaattattgtcaaaatttatgtttattagccaaatta
ttcctcaattcaaaaacattgtattatgatgtcgaaccattcattttttatgtattgaca
gaaattgatgagaaaaacccatcaaattatcattttgttggatattttctgaaggagaaa
ttgaatagctcagattataacgtctcatgtattttaactttacccatttatcaaagaaaa
gggtatggtaatctattgattgatttcagttatttattaagtcggaatgagttcaagtat
ggaacaccggaaaaaccattaagtgatttgggtttactaagttatagaaattattggaaa
gtaacaattgcttataaattgaaacaaatttacgataaatacttttcatgcaatgccaat
ggggatggtgacagtgtcagcgacaatgcaaggctcagtttatctattgatacactttgt
aaattgactggcatgataccatctgatgttattgttgggctagaacaattagattcatta
gcaagaaatccaataactcataattatgccattgtgattaacttggataaaatcaacact
gaaattgctaaatgggagaaaaaactgtatactaaactagtctatgagaaattattatgg
aaaccaatgttatttggtccaagtggaggaatcaattctgcaccatcaattcaaccacca
caaccacaatcaacatcagtaacaacgacaacaatgtcagctagagaaggtactacaaat
tctcacccaaaaccagttattcctcaaaatagtatttcattaatcacaaactttttaaaa
gatgacatcaacaatccttacacatttgaggaagaaggatttaaagaaattgaagctcac
agagaaactgaaaatgaagagataaagaatgcaagcttagtagaatatgttacttgttat
cctggcatagtagtgaacaatcatttcgtcaatggtggtggtggtagtggtgaactgaat
ggctcaaatgatcaaatcaagggccacaaaaagatgttgaagaaaaggaaaagaattata
gatgatgatgatgatgatgatgatgatgatgacgatgatgacgatgagattgaaaaaata
tttgaaattgatgagatcccgagtaacgacgaaaatgaacccgattttgaagatgacagc
gacgatgtggatgattttatggatgatgatgaagaagaagtagtggagattaaagacaat
gattccgatgaggatgtatctgaagatataattgaaattttggacgatgacgaccaagag
gaagaagactggagaagaacttggaaacgaagggtaccatcacctcccaaaaggaaaact
gtcaatgtattgactggcaacaataacaaaccaagaggtagagggagaccaagaggaaca
ttcaaattaaaagcttaa

DBGET integrated database retrieval system