KEGG   Candida albicans: CaO19.2801Help
Entry
CaO19.2801        CDS       T00189                                 

Gene name
UBP2
Definition
Ubiquitin-specific protease.
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.2801 (UBP2)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.2801 (UBP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 516 aa AA seqDB search
MIYSNKRCVQPSKELAYLSFLPLSQPVNFKNQKKTDYSGRTTIEENKQVQLAETKDNQSV
GTEFVHGELEGVLYQQSENGLSTDKDVTMTDGDDEINTEVKDIIDMDREVETGMEIETDV
DESNKNYSMAVESPSSSRSMIEDEVETPDTSSSEDDVVGSSPKILPISSDQIESTIEVGR
QQDVTECIENVTYQIETALPPQLIDKDGEQHDLIKQLFCGKTKQTITPLDKPDEPPRVSL
ERFFSLIINVSDHPKSIYDALDYYFNEDVVKLDEGLVKKSITISELPQILQFHVQRVLFD
REKLMAYKSIEPIPFSDKIFLDRYLDTDDEEILYKRNQVFEWKREISKLQQYKSDLLKID
PETSVSLIDSLKITEKYLENKIISDDSLSIELSTIQTINDEIRKLTSNLEDIDNRLNELN
HLISIQFQDYKSIAYNIFAVFIHRGEASYGHYWVYIKDPHNNNIFRKYNDEIVTEVPASE
IFNFLETNTATPYYIVYIKEELESSYIEPLKREIKE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgatttatagcaacaaaagatgcgttcaacctagtaaagaattggcatatttatctttt
cttccattgtcacaaccagttaatttcaaaaatcaaaagaagaccgattatctgggtaga
actacaattgaggaaaataaacaagttcaattagctgaaaccaaggacaaccagagtgtt
ggcacagaatttgtgcatggcgaacttgaaggagtattatatcagcaatcagaaaatgga
ctcagtactgataaagatgtaactatgactgatggcgatgatgagatcaatacagaagta
aaggatattatagacatggatagggaagttgaaactggaatggaaattgaaacagatgtt
gatgaaagcaataaaaattattccatggccgttgaatcacccctgtcgtcaagatctatg
attgaggatgaagtagaaacccctgatacttcttcaagtgaggatgacgttgtgggatcg
agtcccaaaatattacccatactgagtgatcaaattgaaagcacaattgaagttggtaga
cagcaagatgtcactgaatgtattgaaaatgtcacatatcaaattgagacagcattacca
ccacagttgatagataaagatggcgaacaacacgatttaatcaaacaattattttgcgga
aaaactaaacaaaccatcactcccttggataaacctgatgagccacctagagtttcttta
gaaaggtttttcagtttgattattaatgttagtgatcaccccaagagtatttatgacgcg
ttggattattactttaatgaagatgtggttaaattggatgaaggattagttaaaaaaagt
attaccattctggaattgccacagattttgcaatttcacgtgcaacgagttttatttgat
cgtgaaaagttgatggcatataaatcaattgaaccaattccgttcagtgataagattttt
ttggatagatacttggataccgacgacgaagaaatcttatataaaagaaaccaagtgttt
gagtggaaacgtgaaattctgaaattacaacaatataaatctgatttattgaaaatcgac
cctgagacatcggtgtcattgattgatagtttgaaaatcacggaaaaatatcttgagaac
aaaattatcctggacgattctttgagtattgaattgtctaccatacaaacgattaatgat
gagatcagaaaattaacatcgaatttagaagatattgataatcgattgaatgaattgaat
catttaataagtatacagttccaagattataaatctattgcatataatatatttgccgtt
ttcattcatcgtggtgaagcaagctatgggcattattgggtatacatcaaagatccacat
aataataatatattccggaagtataatgatgaaattgtcactgaagttcctgctagtgaa
atattcaatttcttggaaacaaacaccgctactccttattatatcgtttatatcaaagaa
gaattagaatcaagttatatagaacctttaaaaagggaaattaaagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system