KEGG   Candida albicans: CaO19.2886Help
Entry
CaO19.2886        CDS       T00189                                 

Gene name
ERK1
Definition
MAP kinase-like orf; aka CEK1; one of two protein kinase genes similar to S. cerevisiae MAP kinases FUS3 (YBL016W) and KSS1 (YGR040W) involved in pheromone signal transduction
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CaO19.2886 (ERK1)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CaO19.2886 (ERK1)
Exosome [BR:cal04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CaO19.2886 (ERK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 423 aa AA seqDB search
MMNIDQHHQLQQQHQQQMLQQQAQAQAQAQAQAQQQQQQQQQAAAAAAAANAAATTSSSS
PRQVSFNVSDHYQILEIVGEGAYGIVCSAIHKPSQQKVAIKKIEPFERSMLCLRTLRELK
LLKHFNHENIISILAIQRPINYESFNEIYLIQELMETDLHRVIRTQNLSDDHIQYFIYQT
LRALKAMHSANVLHRDLKPSNLLLNSNCDLKICDFGLARSIASQEDNYGFMTEYVATRWY
RAPEIMLTFQEYTTAIDVWSVGCILAEMLSGRPLFPGRDYHNQLWLIMEVLGTPNMEDYY
NIKSKRAREYIRSLPFCKKIPFSELFANTNNNTSTSTSNTGGRTNINPLALDLLEKLLIF
NPAKRITVEDALKHPYLQLYHDPNDEPISDKIPEDFFDFDKMKDQLTIEDLKKLLYEEIM
KPL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatagatcaacatcatcagcttcaacagcaacatcaacaacaaatgttacaa
caacaagctcaggctcaggctcaggctcaagctcaagcacaacaacaacaacaacaacaa
caacaggcagcagccgcagccgcagcagctaacgctgcagctactacttcttcttcttcc
cctcgtcaagtttcattcaacgtatctgatcattatcaaatattagaaattgttggagaa
ggagcatatggaatagtttgttcagccattcataaaccatcacaacaaaaagttgccatt
aaaaaaattgaaccatttgaaagaagtatgttatgtttacgtacattacgagaattaaaa
ttattaaaacattttaatcatgaaaatatcattagtatattagctatacaacgaccaatt
aattatgaatcatttaatgaaatttatttaattcaagaattgatggaaactgatttacat
cgagtcattagaactcaaaatttatctgatgatcatatacaatatttcatttatcaaact
ttaagagctttaaaagctatgcattcagctaatgtattgcatcgagatttaaaaccactg
aatttattattaaattcaaattgtgatttaaaaatttgtgattttggtttagcaagatca
attgcttcacaagaagataattatggattcatgacagaatacgtagctacaagatggtat
agagctccagaaatcatgttaacttttcaagaatatactactgctattgatgtttggtca
gttggttgtatattggcagaaatgttgagtggtagacctttattccctggtagagattat
cataatcaattatggttaattatggaagttttaggaacaccaaatatggaagattattat
aatattaaatctaaacgagcaagagaatatattagaagtttacccttttgtaaaaaaatt
ccgttcagtgaattatttgccaataccaacaacaatactagtactagtactagtaatact
ggcggtaggacaaatattaatccattggcattagatttattagaaaaattattaattttt
aatcctgctaaaagaattactgttgaagatgctttaaaacatccttatttacaattatat
catgatcctaatgatgaaccaattagtgataaaatcccagaagattttttcgattttgat
aaaatgaaagatcaattaacaattgaagatttgaaaaaattgttatatgaagagattatg
aagccattataa

DBGET integrated database retrieval system