KEGG   Candida albicans: CaO19.3231Help
Entry
CaO19.3231        CDS       T00189                                 

Gene name
CDC27
Definition
similar to S. cerevisiae CDC27 (YBL084C) anaphase promoting complex TPR repeat subunit
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cal  Candida albicans
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:cal04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:cal04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cal04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 875 aa AA seqDB search
MHSTTGGRIGSRSGSTSTSNSNSAAGGTRATGATTTTTTSSSTARILGPTLFQDETNSNP
NPKYIQQYLRSIIIHSLDTLNYQNAEFASERLLALMEQKREQQSHHHNHSQPQSQRDDEN
DEFLDSIYLYCLVLYRQDKYKTCYYKLSNLKKFDHHLSCSFLYGKCCLKLNKFKEGIFHL
IKTKKYHDINTSTTNNNNTSKFSGANTSNNDRFNKFNYEYNRNINPDISSIYHILGDLYR
EINDLKNSCMNYTLCLKLNQFDFEAFQKLCKLGVNIRVKSIFKFQHQPYSKNNINNAFTN
VNVNTNTNSNNEGPTIPDLTNPFTDRSFNSKLTPSIHVDDFNFSTPRVKTTNNNTSISSD
AALRKSNLNNGSTTNAISNNSGGSTNNPSSINAAVSVAAAAAAAAASTTTTNNNNNNLDF
EFTKPSYPDDKRKSQSTYLRITSRLISQPQSSHNQHHNHNHHQQQQQQQQQTGSSQMETP
KKRNLKRNNSATLDPIYHQGTSASNSTTNAIPGISAATSSPATSSSTASASSLSSSSSII
ITKEIEKSEKHLLQLYLNLGKSYRSMCKYDCYKAIRMLETSLNEFEKNTPWVLSKLGRLH
YEIVNYPQSELYFTKLRKLDRTRLQDMEYYSTLLWHLNKKVELTYLANELHDLQPNAAIT
WCVIGNLFSLIHEPNESIKCFNRAIKLDKKFTYAYTLKGHEYFSNDNYEMALENFRISLL
LDPRHYNALYGLGMIYINLGDYEKADYHFRKAISINPINIILICCCGMVLEKLNKRTLAI
KQYELAHKLQPLNPLPIFKLGQLYFSLKNYSLALKNFEILKNLAPNEASVHFLLGQLYNL
QNDKFLAIKEFTVALNLDPKGNYLIREAMESLKKS
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgcattctactacaggaggaagaataggatcaagatcaggatcaacctcaacctcaaac
tcaaactcagcagctggaggaacaagagcgacgggagccacaacaacaacaaccacgtca
tcatcaacagcaagaatattaggtcctactcttttccaagatgaaaccaattctaatcct
aatcctaaatatattcaacaatatttaaggtcgattattattcattcattagatacttta
aattatcaaaatgctgaatttgccagtgagagattattggctttaatggaacaaaaacgt
gaacaacaactgcatcatcataatcattcacaaccacaatcacaaagagatgatgaaaat
gatgaatttttagattcaatctatttatattgtcttgtattataccgacaagataaatat
aaaacttgttattataaattaagtaatttgaaaaaatttgatcatcatttaagttgttca
tttctttatggtaaatgttgtttaaaattgaataaatttaaagaagggatatttcatttg
attaaaactaaaaaatatcacgacataaatactagtactactaacaacaacaacacgtct
aaattttctggtgcaaacacaagtaataatgatcgattcaataaattcaattatgaatat
aatcgaaacattaatcctgatatatcactgatttatcatatattgggtgatttatatcgt
gagatcaatgatttgaaaaatagttgtatgaattatactttatgtttgaaattaaatcaa
tttgattttgaagcatttcaaaaattgtgtaaattgggagttaatattagagtcaaatca
attttcaaatttcaacaccaaccatatagtaaaaataatatcaataatgccttcacaaat
gttaatgttaacactaatactaattcaaataatgaaggaccaacaatacctgatttaaca
aatccatttactgatagatcattcaactcaaaattaactccatcaattcacgttgatgac
tttaatttttcaacaccaagagtgaaaactacaaataataataccagtataagttccgat
gccgctttacgtaaatctaatttgaacaatggatcaacaacaaatgcaatctcaaacaat
agtggaggtagtaccaataatccgagttctatcaatgctgcagtttcagtggcagcagcg
gcggcagcagcagcagcttcaactaccacgacaaacaataataacaacaatttagatttc
gaatttaccaaacctagttaccccgatgataaaagaaaaagtcaaagcacttatttaaga
ataacatcaagattgatatcacagccacaatctctgcacaaccagcaccacaaccacaac
caccatcaacaacaacaacaacaacaacaacaaacaggatcatcgcagatggaaacacct
aaaaaaagaaatttaaagcgtaataactcggctacgttagatccaatatatcatcagggc
acttctgcatctaattccactacaaatgcaattccaggtataagtgcagcaacatcatca
cctgcaacatcatcatctactgcttccgcatcatctctatcttcttcatcatcaattata
attactaaagagattgaaaaaagtgaaaaacatcttttgcaattatatttaaatttaggt
aagagttatcgaagtatgtgtaaatatgattgttacaaggcaataagaatgttagaaacg
tcattgaatgaatttgaaaaaaatactccttgggttttaagtaaattgggaagattacat
tatgaaattgttaattatcctcaatcagaattgtatttcaccaaattgagaaaattggat
cgaactcgtttacaagatatggaatattatctgacattattatggcatttgaataaaaaa
gttgaattgacttatttagccaatgaattacatgatttacaacccaatgctgccatcact
tggtgtgtgataggtaatttgttttcattgattcatgaaccaaatgaatcaatcaaatgt
ttcaatagagcaatcaaattagataaaaaattcacttatgcttatacattaaaaggtcat
gaatatttcagtaatgataattatgaaatggcattagaaaatttccgtattagtttatta
ctagatcctcgtcattataatgccttgtatggattaggaatgatttatattaatcttggt
gattatgaaaaagccgattatcatttccgtaaagcaatttccattaatccaatcaatata
attctaatttgttgttgtggtatggtattggaaaaattgaataaacgaactttagctatt
aaacaatatgaattagctcataaattacaaccattaaatccattaccaatttttaaattg
ggtcaattatattttagtttgaaaaattatctgttagctttgaaaaattttgaaattttg
aaaaatttagcacctaatgaagcaagtgttcatttcttattaggacaattgtataattta
caaaatgataaatttttggcaattaaagaatttaccgtggctttaaatttagatcctaaa
ggtaattatttaattcgtgaagctatggaatcattgaaaaagagttga

DBGET integrated database retrieval system