KEGG   Candida albicans: CaO19.3249Help
Entry
CaO19.3249        CDS       T00189                                 

Gene name
LAG1
Definition
similar to S. cerevisiae Longevity-assurance proteins LAG1 and LAC1 involved in ceramide biosynthesis
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cal  Candida albicans
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cal00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 412 aa AA seqDB search
MSSSSSSLGVPHENPIRHRSSSVGRIDVGDTSASLSTMPTTRSSRRRSIARLKELQDNST
TDSAIVHKLYVGFRELTYRHTWIIPLIVLLMAFGTYYLSSPSGKVHQVLEDMIIPSYHIP
GTDQYGKGGNDFKFVGFYAIFFTFLREFMMCCVLRPISVWFGIKKEAKQKRFLEQTYAMF
YYGITGPFGLWIMRRLPLWYFNTTQFYINYPHKTHDIYFKIYYLGQAAFWVQQSVVLILQ
LEKPRKDFKELVLHHIITIALIWCSYRFHFTWMGLAVYITMDISDFFLALSKTLNYLESP
ITGPFFVIFIGVWIYLRHYINLQILWSVLTEFRTVGDFELNWITQQYKCWISQPITFFLI
FALQLVNFYWLVLIFRILYRYVFTGVSKDERSDDEDEDEDSEDSADEKKKEQ
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgtcatcatcttcacttggtgttccacacgaaaacccaattcgtcatcgttct
tcatctgttggtagaatagacgttggtgacacatctgcatctttatcaaccatgccaacc
acgaggtctctgagaagaagatctattgccagattgaaagaattacaagacaattcaact
acagattcagcaattgttcataaattatatgttgggtttagagaattaacttatagacac
acttggattattcctttgattgttttactcatggcttttggtacatattatctttcatca
ccttcaggaaaagttcatcaagtattagaagatatgattattccatcttatcatatccct
ggtactgatcaatatggtaaaggaggtaacgatttcaaatttgttggattttatgctatt
tttttcacttttttgagagaattcatgatgtgttgtgttttacgtccaattagtgtttgg
tttggtattaaaaaagaagccaaacagaagagatttttagaacaaacttatgccatgttt
tattatggtattactggtccatttggtttatggattatgagaagattaccattatggtat
tttaataccactcaattttatataaattatccacacaagactcatgatatttatttcaaa
atttattatcttggtcaagcagcattttgggtccaacaatcagtagttttaattttacaa
ttggaaaaaccaagaaaagatttcaaagaattagtcttgcatcatattatcactatagcg
ttgatttggtgttcttatagattccatttcacttggatgggattggctgtttatattact
atggatatatctgatttctttttggcattatcgaaaactttgaattatttggaatctccc
attaccggtccatttttcgttatatttattggcgtttggatttatttgagacattatatc
aatttacaaatattatggtcggttttaactgaattcagaaccgttggtgatttcgaattg
aattggatcactcaacaatataaatgttggatctcacagccaatcacttttttcttgatt
tttgccttacaattagtcaacttttattggttagtattgattttcagaattttatacaga
tatgttttcactggggttagtaaagatgaaagaagtgatgatgaagatgaagatgaagat
agtgaagattctgctgatgaaaagaaaaaggaacaatag

DBGET integrated database retrieval system