KEGG   Candida albicans: CaO19.3278Help
Entry
CaO19.3278        CDS       T00189                                 

Gene name
GSY1
Definition
UDP-glucose-starch glucosyltransferase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cal  Candida albicans
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CaO19.3278 (GSY1)
Enzymes [BR:cal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CaO19.3278 (GSY1)
Glycosyltransferases [BR:cal01003]
 Polysaccharide
  Storage polysaccharide
   CaO19.3278 (GSY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 661 aa AA seqDB search
MARDIDNHLLFEVATEVAHKVGGIYSVLKSKAPVTVAEYRERYTLLGPLHYDSAQIEVEE
LPVTDPHIKQTLDSMSSKGIRWLYGRWLIEGAPRVLLFDIWSAGHYLNEWKADLWNVAGI
PTPDHDSETNDAILLGYLVAWFLGELVYNDRDRAVICQCHEWLAGIALPLCRKRRIDVTT
IFTTHATLLGRYLCAGSTDFYNNLDKFDVDAEAGKRGIYHRYCIERSATHSADVFTTVSD
ITAYEAEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAIKKAKINEFVKGHFYGNYDFDL
DNTLYFFIAGRYEFRNKGCDFFIESLARLNHKLKEAGSKTTVVAFIIMPGKTQSYTVETL
KGQAVVKQLESTIGEVQKKVGERLFEYCARYPNTDHHGNDEVPTIDELIKPADRVLLKRR
IFALKRDGLPPIVTHNMVDDSTDPVLNHIRRVQLFNKPEDRVKIIFHPEFLNANNPILSL
DYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMNDLVENPTDYGIY
IVDRRMKSVDESINQLTDYMFDFCAKSRRQRINQRNRTERLSVLLDWRSVHSEYSKARLL
ALKRAYPDYVGEKVVESKMKITRPMSVPGSPRSLLLTPGDLGSLQDANQDISYFELGEEE
T
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggctagagatattgataatcatttattatttgaggttgctactgaggtagctcataaa
gttggaggtatttactccgttttaaaatcaaaagccccagtcactgtagctgaatatcgt
gaacgttacactttattgggtccattacattatgactcagcacaaattgaagttgaagaa
ttgccagttaccgaccctcatatcaaacaaacccttgattctatgtcttccaaaggtatt
agatggctttatggtagatggttgattgaaggtgcaccaagagtattattgtttgacatt
tggtctgccggccattatttgaatgaatggaaagctgatttgtggaatgttgctggtatc
cctacccctgatcatgacctggaaaccaatgatgctattttgttgggttatttggttgct
tggtttttgggtgaattggtttataacgaccgtgatcgtgctgttatttgtcaatgtcat
gaatggttagcaggtattgccttgccattatgtagaaaaagaagaattgacgttaccact
attttcactacccatgcaacattattgggaagatacttgtgtgctggtagtaccgatttc
tacaacaatttggacaagtttgatgttgatgctgaagctggtaaaagaggtatttatcac
cgttactgtatcgaaagatctgctacgcattcagctgatgtgttcactacagtttctgat
attactgcctatgaagccgaacatttgttgaaaagaaaaccagatggtgttttacctaat
gggttgaatgttgtcaagttccaagcagttcatgaattccaaaatttgcatgctatcaaa
aaggccaagatcaatgaatttgtcaaaggacatttctatgggaactatgattttgattta
gacaataccttatatttcttcatcgccgggagatacgagtttagaaataaagggtgtgat
ttctttattgaatcgttagcaagattgaatcataaattgaaagaggcaggttccaaaacc
acagttgtggctttcattattatgccgggaaaaactcaatcctacactgttgagactttg
aaaggtcaggctgttgttaaacaattagaatcaactattggtgaagtgcaaaagaaagtt
ggtgaaagattatttgagtattgtgctagataccctaatactgatcatcacggaaacgat
gaagttccaactattgatgagttgattaaaccagccgatagagttttgttgaaaagacgt
atatttgcattgaagagagatggtttgccaccaattgtcactcacaacatggttgatgac
agtactgatccagtcttgaatcatattagaagagttcaattatttaacaaaccagaagat
agagttaagattattttccatccagagttcttgaatgctaacaaccctattttgtcatta
gattatgatgaatttgttagagggtgtcatttgggtgtgttcccatcctactacgaacct
tggggttacactcctgccgagtgtaccgttatgggtataccttctattaccaccaatttg
tctggatttgggtgttacatgaatgatttggttgaaaacccaactgattacggtatttat
attgttgacagaagaatgaaatctgtcgatgagtctatcaatcaattgactgattacatg
tttgatttctgtgcgaaatccagaagacaaagaatcaaccaaagaaatagaactgaaaga
ttgagtgttcttttggattggagatcagttcattccgaatattctaaggctcgtttgttg
gcacttaaaagagcttatcctgattatgttggtgagaaggtagttgaatccaagatgaaa
atcactcgaccaatgtcagttccaggttctccaagaagtttgttactcacgccaggtgat
cttggctcattacaagacgctaaccaagacattagttattttgaattgggtgaagaagaa
acttaa

DBGET integrated database retrieval system