KEGG   Candida albicans: CaO19.3418Help
Entry
CaO19.3418        CDS       T00189                                 

Gene name
AFP98
Definition
Arginase/agmatinase family protein similar to S. pombe SPBC8E4.03
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cal  Candida albicans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CaO19.3418 (AFP98)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CaO19.3418 (AFP98)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 361 aa AA seqDB search
MKLLALLTLLPLVISTNLEEKWGGLWPFQGIATFAHLEHFQCLIESEKQFDIGIIGVPFD
TAVSYRPGARFGPRAIRDASQRQNNLRGFNPKALFDPYQSWARIIDCGDIPVTPMDNSAA
YKQMSEAFKDLLNRKSLNNTEIPPRYIALGGDHSVLLPHIRALHKIYGPVNIIHFDAHLD
TWKPNKYPTSEKNDINHGSMLWKAYEEGLTTKHNIHVGVRTRLSGLEDLQDDDEQNFVRI
EADDIWLKGPQWVVDKILATIPKDTATYISVDVDVLDPGFTSGTGTQEPGGFLPRELIYL
LRSINGLTVVGADVVEVSPAYDIAEITATNGAQIAYEVLTSMVKRGNIDKSLVKSVVHVF
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacttgcacttttgacattgcttccgttagttatatccacaaacttggaagag
aaatggggtggattatggccatttcagggaatcgctacatttgcacatctagaacatttc
caatgcttgattgaatcggaaaaacaatttgacatagggataatcggtgtaccatttgat
accgctgtttcttatcgaccaggtgcacgttttggacctcgcgcaatcagggatgcgtct
caaagacaaaataatttacgtggattcaaccctaaagcattgtttgatccttatcaatca
tgggctagaataattgattgtggagatatccctgtgacaccaatggacaattctgctgcc
tataaacaaatgagtgaagccttcaaagacttgttgaatagaaaatctttgaataacacg
gaaatcccaccaaggtatattgcattaggtggagaccattcggtgttattaccacatatc
cgagcattgcataagatttatgggccagtcaacattattcattttgatgctcatttggac
acttggaaaccaaacaaataccctacatcggaaaagaatgacattaatcatggatcaatg
ttgtggaaggcgtacgaagaaggattaactactaaacacaacattcatgttggggtacgc
acaagactttcagggttggaagatctacaagatgatgatgaacaaaattttgtcagaatt
gaagctgatgatatatggttgaaaggacctcaatgggttgttgataaaattttagccacc
ataccaaaagacacggcaacctatatttcagtagatgttgatgttttagatccaggattt
acaagtggtactggaacacaagaacctggtggatttttaccgagagagttgatatattta
ttgagaagtataaatggtttgacagtggttggtgctgatgttgttgaagtttcaccagct
tacgatatcgcggaaattactgcaactaatggtgctcaaatcgcttatgaagtattaacc
agcatggtgaaaagagggaatatagataaatctttggttaaactggttgttcacgttttc
gattag

DBGET integrated database retrieval system