KEGG   Candida albicans: CaO19.3496Help
Entry
CaO19.3496        CDS       T00189                                 

Gene name
CHC1
Definition
presumed vesical coat protein (clathrin heavy chain)
Orthology
K04646  
clathrin heavy chain
Organism
cal  Candida albicans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CaO19.3496 (CHC1)
Exosome [BR:cal04147]
 Exosomal proteins
  Proteins found in most exosomes
   CaO19.3496 (CHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1671 aa AA seqDB search
MSNDIPIDFTELTQLTELGIPQTSLDFKSTTLESDHYICVRESGAQGNTVAIVNLKNNNE
VTRKNMTADNAIMHPKEFVISLRANGTTLQIFNLGSKQRLKAFTMDQPVIFWKWLDDTYL
GLVTQSSIYYWNVFDGTNNGPTKLTDRHHTLNNCQIINFVAEPDLNWFAVTGIAQEDGRI
AGHIQLYSKSRNVSQAIEGHVCKFASISLSGGVQPTKVFCVGNKNAQGQGNMHIIEIDHV
DGNPQFQKKVVDIFFPPDASNDFPISLQASNKYGIVYVLTKYGFIHLYDMETGANLFVNR
ITADPVFTASSYNDGTGLITINKAGQVLSVEVSRDKIIPYVLDKLSNVPLALALSSRGGF
PGAENLFQQQFQTYLNQGDYSNAAKVAASSEQLRTQDTINKLKNITPQPGQISPILQYFS
TLLDRGTLNKFESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDTTLALAV
YIRANVNIKVVSCLAELGQFDKILPYCQKVGYNPDYTNLIQNLVRVNPDKASEFATSLLS
SPDANLNVEQIADLFFSQNYIQQGTAFLLDALKNDTPAEGHLQTKVLEINLLHAPQVADA
ILGNQMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLPSDWLVSYFGQL
NVDQSVACIKELLSNNMQQNLQVVIQVATKYSDLIGAAKLIKIFEEYKCTEGLYYYLSSI
VNLTQDPDVVFKYIQAAARMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLDDQLPLIIVC
DRFNFVHDLILYLYKNQYFKFIEVYVQSVNPANTPQVVAGLLDVDCDENIIKGLLMSVLG
RVPIKELVEEVEKRNRLKILLPFLEKTLEGGSNDQEVYNTLAKIYIDSNNSPEKFLQENN
NYDTLVVGKYCEKRDPYLAYISYSKGGNDDQLISITNENKMYKYQARYLLSKSDIELWNK
VLSSDNIHRRQLVDQVISTGIPELDDPEPISITVKAFMENDLPEELMELLEKIILEPSPF
SENASLQGLMILTAIKADSSKVSSYIEKLDKFDPNEIAPLCIDNGLNEEAFEVYDKFELR
SEAMKVLVEDIVSLDRAEQYAEKYDTPELWYQLGTAQLDGLRIPEAIDSYVKSKNPENFA
QVIEIAEHAGKEEELITFLDMARETLREPVVDGALINAYATLDRLSDMEKFVGGSNVADL
EAIGDKLFEAKNYKGAKILYSNVSKYSKLATTLVYLGDYQGAVDCARKASNTQVWKQVNS
ACIENKEFRLAQICGLNLIIDAEELPELVKTYEYNGYFNELIALFENGLSLERAHMGMFT
ELAILYAKYSPEKVMEHLKLFWSRINIPKVLTACEDAHLYPELIFLYCHYEEWDNAALTM
IEKSEVAFDHSSFKEIIVKAPNLEIHYKAIQFYMNENPSLLVDLLKVLTPKLDLPRVVRM
FVQSDNLPMIKPFLISVLDKNNSVVNSAYHDLLIEEEDYKSLRSSIENESNNRFNKLDLA
ERLEKHDLIFFRQIAATLYTKEKKFNRAISILKTDKLWPDLLRTVAISKSKKIAHELLDY
FVETGNHECFVALLYTSYEFIANDYVMELSWLHNLSNFIKPYEISIAFENQKKLNEVYQD
LQKRKEADRKQEEEPGVGQPLMLTNGPMSYQGTGATGIGYQPTGTGFGNAF
NT seq 5016 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatattcctattgactttactgaattaacccagttgaccgaattgggaatt
ccacagacttcgttggatttcaaatcaacaactttggaatcagatcactacatatgtgtc
cgtgaatctggagctcaaggaaacaccgttgcaattgtcaatttgaaaaacaacaatgaa
gtgactagaaaaaatatgaccgccgataatgccattatgcatcctaaggaatttgttatt
tcattgagagccaatggaaccactttacaaattttcaacttgggatcaaaacaaagattg
aaggctttcactatggatcaaccagtgatattttggaaatggctcgacgatacatattta
gggttggtaacacaatcatcaatctactattggaatgtatttgatggaaccaacaatgga
ccaaccaaattgaccgatagacaccacacattgaacaattgtcaaatcataaactttgtc
gctgaacctgatttgaattggtttgctgtcaccggtattgctcaagaagatggtcgtatc
gctggtcacatccaattatactcaaaatcaagaaatgtttcgcaagctatcgaaggtcat
gtatgtaaatttgcttctatatctttatctggaggtgtccaaccaactaaagttttctgt
gttggtaacaagaatgcccaaggtcaaggcaacatgcatattattgagattgatcatgtt
gatggcaatccccaatttcaaaagaaagtggttgacattttctttccacctgatgcttcc
aatgatttcccaatcagtttacaagcttctaacaagtacggtattgtttatgtattgacc
aaatacgggttcattcacttatatgatatggaaactggggccaacttgtttgtcaacaga
ataactgccgatccagtattcactgcttctagttataacgatggcactggtttaataact
atcaacaaggctggtcaagttttaagtgttgaagtttcccgtgacaagatcattccttat
gttttggataaattatcaaatgtcccattggctttagctttatcctctcgtggtggattc
ccaggggctgaaaacttgttccaacaacaattccaaacttacttgaaccaaggtgattac
agtaatgccgctaaagttgccgcttcatctgagcaattgcgtactcaagataccatcaac
aaattgaagaatattactcctcaaccaggccaaatatcaccaattttgcaatatttctcc
actttgttagacagaggtactttgaacaaatttgaatcgattgaattggcaaaaccagtt
ttacaacaagatcgtaaaccattatttgaaaaatggttgaaagaagacaaattgacatct
tcagaagaattaggggatatcgtcaagtcttacaatgatacaactttggcacttgctgtt
tatattagagccaatgtaaatatcaaagtggtttcttgtttagctgaattaggccaattt
gataaaattttgccatactgtcaaaaagttggttacaatcctgattacaccaatttgatt
caaaacttggttagagtcaaccctgataaggccagtgaatttgctacttccttattgtca
agtccagatgccaacttaaacgttgaacaaattgctgacttgttcttttcacaaaattac
attcaacaaggtactgcattcttattggatgctttgaaaaacgacactccagctgaaggt
cacttgcaaaccaaagttttggaaatcaacttgttacatgcacctcaagttgctgatgcc
attttaggtaatcaaatgtttagtcattatgataaaccaaccattggtaaattatgtgag
aaatcaggattattccaaagagctttggaacattatgatgatttgaaagatattaagaga
gtcattgttcacactaatgttttaccaagtgattggttggtttcgtattttggtcaattg
aatgtcgatcaatctgtcgcttgtatcaaagaattgttgagtaacaatatgcaacaaaac
ttgcaagtggttattcaagtagccacaaaatactcagatttgattggtgctgccaaatta
atcaaaatttttgaagagtacaagtgtactgaaggattgtactattatttaagttctatt
gtcaatttgactcaagacccagatgttgttttcaaatacattcaagctgcagctagaatg
aaccaaaccaaagaaatcgaaagagtggttagagataacaatgtttataacggtgaaaaa
gtgaagaactttttgaaagaatttaaattggatgatcaattacctttaatcattgtttgt
gatagattcaactttgttcacgatttgattttgtatttgtacaagaatcaatactttaag
tttattgaagtttatgttcaatcagttaatccagccaatactccacaagttgttgccggt
ttattggatgttgattgtgatgaaaacatcattaaaggcttgttaatgtctgttttgggt
agagttccaatcaaagaattggttgaagaagtcgaaaagagaaacagattgaaaatcttg
ttaccattcttggaaaaaacattagaaggtggatctaatgatcaagaagtatacaacact
ttagctaaaatctacattgattccaacaattcaccagaaaagtttttgcaagaaaacaac
aactacgatacattggttgttggtaaatactgtgaaaagagagatccatatttggcttat
atttcttattctaaaggtggcaacgatgaccaattgatttctattaccaacgaaaataaa
atgtacaaataccaagccagatatttgttatctaagtctgacattgagttatggaacaaa
gttttaagctctgacaatatccacagaagacaattggttgatcaagtcatttccactggt
attccagaattggatgacccagaaccaatctcaattactgttaaggcatttatggaaaat
gatttaccagaagagttgatggaattattagaaaagatcattttggaaccatctccattc
agtgaaaatgcatcattacaaggattgatgattttgactgctatcaaagctgattcatcg
aaagtgtctagttatattgaaaaattagacaaatttgaccctaacgaaattgctccatta
tgtattgataatggattgaatgaagaagcatttgaagtttacgacaaatttgaattaaga
tcagaagctatgaaagttttagttgaagatattgtttcattagacagagctgaacaatac
gctgagaaatatgacacccctgaattgtggtaccaattgggtactgcacaattggatggt
ttacgtatcccagaagcaattgactcttatgttaaatctaagaacccagaaaatttcgct
caagtgattgaaattgctgaacatgctggaaaggaagaagaattaattactttcttggat
atggccagagaaacattaagagaaccagttgttgatggtgctcttattaatgcttatgcc
actttagatagattgagtgatatggaaaaatttgttggtggctccaatgttgctgatttg
gaagctattggtgacaaattatttgaagcaaagaattataaaggtgctaaaattttgtat
tctaacgtttccaaatattccaaattagctactactttggtttacttgggtgattaccaa
ggtgctgttgactgtgctagaaaagcttctaacactcaagtttggaaacaagttaacagt
gcttgtattgaaaacaaagagttcagattggctcaaatttgtggtttgaatttgattatc
gatgctgaagaattgcctgaattggtcaagacttacgaatacaatggttatttcaacgaa
ttgattgctcttttcgagaatgggttgagtttggaaagagctcacatgggtatgttcacc
gaattggctatcttgtatgctaaatactctccagaaaaagttatggagcatttgaaatta
ttctggtctagaattaatattccaaaagttttgactgcatgtgaagatgcacacttgtac
ccagaattgatctttttgtactgtcattacgaggaatgggataatgctgcattgaccatg
attgaaaaatcagaagttgcatttgaccactcttctttcaaggaaatcattgttaaggca
ccaaacttggaaattcattacaaggctattcaattctacatgaatgaaaacccttcgttg
ttggttgatttattgaaagtgttaacaccaaaattagatttgccaagagttgttagaatg
tttgttcaaagtgacaacttgccaatgattaaaccatttttgatttctgttttggataag
aacaattctgttgttaattctgcttaccatgatttattaattgaagaagaagattataaa
tctttgagatcatctattgaaaatgaaagcaacaatagattcaataaattggatttggct
gaaagattggaaaagcatgatttgattttctttagacaaattgctgctactttatacact
aaagaaaagaaattcaatagagccatttctattttgaaaactgataaattatggccagat
ttattaagaacagttgctatttccaaatctaaaaagattgctcatgaattattagattac
tttgttgaaacaggtaatcatgaatgttttgttgccttgttgtatacttcttatgaattc
attgctaatgattacgtgatggaattatcatggttgcacaacttgtccaactttattaaa
ccatatgagatttccattgcttttgaaaatcagaagaaattgaatgaagtataccaagat
ttacaaaagagaaaagaagcagatagaaaacaagaagaagaaccaggtgttggccaacca
ttgatgcttactaatggaccaatgagttatcaaggtactggtgccactggaattggttat
caaccaactggtactggatttggtaatgcattctag

  All links  
No link information was found.   
DBGET integrated database retrieval system