KEGG   Candida albicans: CaO19.3496Help
Entry
CaO19.3496        CDS       T00189                                 

Gene name
CHC1
Definition
presumed vesical coat protein (clathrin heavy chain)
Orthology
K04646  
clathrin heavy chain
Organism
cal  Candida albicans
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cal04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1671 aa AA seqDB search
MSNDIPIDFTELTQLTELGIPQTSLDFKSTTLESDHYICVRESGAQGNTVAIVNLKNNNE
VTRKNMTADNAIMHPKEFVISLRANGTTLQIFNLGSKQRLKAFTMDQPVIFWKWLDDTYL
GLVTQSSIYYWNVFDGTNNGPTKLTDRHHTLNNCQIINFVAEPDLNWFAVTGIAQEDGRI
AGHIQLYSKSRNVSQAIEGHVCKFASISLSGGVQPTKVFCVGNKNAQGQGNMHIIEIDHV
DGNPQFQKKVVDIFFPPDASNDFPISLQASNKYGIVYVLTKYGFIHLYDMETGANLFVNR
ITADPVFTASSYNDGTGLITINKAGQVLSVEVSRDKIIPYVLDKLSNVPLALALSSRGGF
PGAENLFQQQFQTYLNQGDYSNAAKVAASSEQLRTQDTINKLKNITPQPGQISPILQYFS
TLLDRGTLNKFESIELAKPVLQQDRKPLFEKWLKEDKLTSSEELGDIVKSYNDTTLALAV
YIRANVNIKVVSCLAELGQFDKILPYCQKVGYNPDYTNLIQNLVRVNPDKASEFATSLLS
SPDANLNVEQIADLFFSQNYIQQGTAFLLDALKNDTPAEGHLQTKVLEINLLHAPQVADA
ILGNQMFSHYDKPTIGKLCEKSGLFQRALEHYDDLKDIKRVIVHTNVLPSDWLVSYFGQL
NVDQSVACIKELLSNNMQQNLQVVIQVATKYSDLIGAAKLIKIFEEYKCTEGLYYYLSSI
VNLTQDPDVVFKYIQAAARMNQTKEIERVVRDNNVYNGEKVKNFLKEFKLDDQLPLIIVC
DRFNFVHDLILYLYKNQYFKFIEVYVQSVNPANTPQVVAGLLDVDCDENIIKGLLMSVLG
RVPIKELVEEVEKRNRLKILLPFLEKTLEGGSNDQEVYNTLAKIYIDSNNSPEKFLQENN
NYDTLVVGKYCEKRDPYLAYISYSKGGNDDQLISITNENKMYKYQARYLLSKSDIELWNK
VLSSDNIHRRQLVDQVISTGIPELDDPEPISITVKAFMENDLPEELMELLEKIILEPSPF
SENASLQGLMILTAIKADSSKVSSYIEKLDKFDPNEIAPLCIDNGLNEEAFEVYDKFELR
SEAMKVLVEDIVSLDRAEQYAEKYDTPELWYQLGTAQLDGLRIPEAIDSYVKSKNPENFA
QVIEIAEHAGKEEELITFLDMARETLREPVVDGALINAYATLDRLSDMEKFVGGSNVADL
EAIGDKLFEAKNYKGAKILYSNVSKYSKLATTLVYLGDYQGAVDCARKASNTQVWKQVNS
ACIENKEFRLAQICGLNLIIDAEELPELVKTYEYNGYFNELIALFENGLSLERAHMGMFT
ELAILYAKYSPEKVMEHLKLFWSRINIPKVLTACEDAHLYPELIFLYCHYEEWDNAALTM
IEKSEVAFDHSSFKEIIVKAPNLEIHYKAIQFYMNENPSLLVDLLKVLTPKLDLPRVVRM
FVQSDNLPMIKPFLISVLDKNNSVVNSAYHDLLIEEEDYKSLRSSIENESNNRFNKLDLA
ERLEKHDLIFFRQIAATLYTKEKKFNRAISILKTDKLWPDLLRTVAISKSKKIAHELLDY
FVETGNHECFVALLYTSYEFIANDYVMELSWLHNLSNFIKPYEISIAFENQKKLNEVYQD
LQKRKEADRKQEEEPGVGQPLMLTNGPMSYQGTGATGIGYQPTGTGFGNAF
NT seq 5016 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgatattcctattgactttactgaattaacccagttgaccgaattgggaatt
ccacagacttcgttggatttcaaatcaacaactttggaatcagatcactacatatgtgtc
cgtgaatctggagctcaaggaaacaccgttgcaattgtcaatttgaaaaacaacaatgaa
gtgactagaaaaaatatgaccgccgataatgccattatgcatcctaaggaatttgttatt
tcattgagagccaatggaaccactttacaaattttcaacttgggatcaaaacaaagattg
aaggctttcactatggatcaaccagtgatattttggaaatggctcgacgatacatattta
gggttggtaacacaatcatcaatctactattggaatgtatttgatggaaccaacaatgga
ccaaccaaattgaccgatagacaccacacattgaacaattgtcaaatcataaactttgtc
gctgaacctgatttgaattggtttgctgtcaccggtattgctcaagaagatggtcgtatc
gctggtcacatccaattatactcaaaatcaagaaatgtttcgcaagctatcgaaggtcat
gtatgtaaatttgcttctatatctttatctggaggtgtccaaccaactaaagttttctgt
gttggtaacaagaatgcccaaggtcaaggcaacatgcatattattgagattgatcatgtt
gatggcaatccccaatttcaaaagaaagtggttgacattttctttccacctgatgcttcc
aatgatttcccaatcagtttacaagcttctaacaagtacggtattgtttatgtattgacc
aaatacgggttcattcacttatatgatatggaaactggggccaacttgtttgtcaacaga
ataactgccgatccagtattcactgcttctagttataacgatggcactggtttaataact
atcaacaaggctggtcaagttttaagtgttgaagtttcccgtgacaagatcattccttat
gttttggataaattatcaaatgtcccattggctttagctttatcctctcgtggtggattc
ccaggggctgaaaacttgttccaacaacaattccaaacttacttgaaccaaggtgattac
agtaatgccgctaaagttgccgcttcatctgagcaattgcgtactcaagataccatcaac
aaattgaagaatattactcctcaaccaggccaaatatcaccaattttgcaatatttctcc
actttgttagacagaggtactttgaacaaatttgaatcgattgaattggcaaaaccagtt
ttacaacaagatcgtaaaccattatttgaaaaatggttgaaagaagacaaattgacatct
tcagaagaattaggggatatcgtcaagtcttacaatgatacaactttggcacttgctgtt
tatattagagccaatgtaaatatcaaagtggtttcttgtttagctgaattaggccaattt
gataaaattttgccatactgtcaaaaagttggttacaatcctgattacaccaatttgatt
caaaacttggttagagtcaaccctgataaggccagtgaatttgctacttccttattgtca
agtccagatgccaacttaaacgttgaacaaattgctgacttgttcttttcacaaaattac
attcaacaaggtactgcattcttattggatgctttgaaaaacgacactccagctgaaggt
cacttgcaaaccaaagttttggaaatcaacttgttacatgcacctcaagttgctgatgcc
attttaggtaatcaaatgtttagtcattatgataaaccaaccattggtaaattatgtgag
aaatcaggattattccaaagagctttggaacattatgatgatttgaaagatattaagaga
gtcattgttcacactaatgttttaccaagtgattggttggtttcgtattttggtcaattg
aatgtcgatcaatctgtcgcttgtatcaaagaattgttgagtaacaatatgcaacaaaac
ttgcaagtggttattcaagtagccacaaaatactcagatttgattggtgctgccaaatta
atcaaaatttttgaagagtacaagtgtactgaaggattgtactattatttaagttctatt
gtcaatttgactcaagacccagatgttgttttcaaatacattcaagctgcagctagaatg
aaccaaaccaaagaaatcgaaagagtggttagagataacaatgtttataacggtgaaaaa
gtgaagaactttttgaaagaatttaaattggatgatcaattacctttaatcattgtttgt
gatagattcaactttgttcacgatttgattttgtatttgtacaagaatcaatactttaag
tttattgaagtttatgttcaatcagttaatccagccaatactccacaagttgttgccggt
ttattggatgttgattgtgatgaaaacatcattaaaggcttgttaatgtctgttttgggt
agagttccaatcaaagaattggttgaagaagtcgaaaagagaaacagattgaaaatcttg
ttaccattcttggaaaaaacattagaaggtggatctaatgatcaagaagtatacaacact
ttagctaaaatctacattgattccaacaattcaccagaaaagtttttgcaagaaaacaac
aactacgatacattggttgttggtaaatactgtgaaaagagagatccatatttggcttat
atttcttattctaaaggtggcaacgatgaccaattgatttctattaccaacgaaaataaa
atgtacaaataccaagccagatatttgttatctaagtctgacattgagttatggaacaaa
gttttaagctctgacaatatccacagaagacaattggttgatcaagtcatttccactggt
attccagaattggatgacccagaaccaatctcaattactgttaaggcatttatggaaaat
gatttaccagaagagttgatggaattattagaaaagatcattttggaaccatctccattc
agtgaaaatgcatcattacaaggattgatgattttgactgctatcaaagctgattcatcg
aaagtgtctagttatattgaaaaattagacaaatttgaccctaacgaaattgctccatta
tgtattgataatggattgaatgaagaagcatttgaagtttacgacaaatttgaattaaga
tcagaagctatgaaagttttagttgaagatattgtttcattagacagagctgaacaatac
gctgagaaatatgacacccctgaattgtggtaccaattgggtactgcacaattggatggt
ttacgtatcccagaagcaattgactcttatgttaaatctaagaacccagaaaatttcgct
caagtgattgaaattgctgaacatgctggaaaggaagaagaattaattactttcttggat
atggccagagaaacattaagagaaccagttgttgatggtgctcttattaatgcttatgcc
actttagatagattgagtgatatggaaaaatttgttggtggctccaatgttgctgatttg
gaagctattggtgacaaattatttgaagcaaagaattataaaggtgctaaaattttgtat
tctaacgtttccaaatattccaaattagctactactttggtttacttgggtgattaccaa
ggtgctgttgactgtgctagaaaagcttctaacactcaagtttggaaacaagttaacagt
gcttgtattgaaaacaaagagttcagattggctcaaatttgtggtttgaatttgattatc
gatgctgaagaattgcctgaattggtcaagacttacgaatacaatggttatttcaacgaa
ttgattgctcttttcgagaatgggttgagtttggaaagagctcacatgggtatgttcacc
gaattggctatcttgtatgctaaatactctccagaaaaagttatggagcatttgaaatta
ttctggtctagaattaatattccaaaagttttgactgcatgtgaagatgcacacttgtac
ccagaattgatctttttgtactgtcattacgaggaatgggataatgctgcattgaccatg
attgaaaaatcagaagttgcatttgaccactcttctttcaaggaaatcattgttaaggca
ccaaacttggaaattcattacaaggctattcaattctacatgaatgaaaacccttcgttg
ttggttgatttattgaaagtgttaacaccaaaattagatttgccaagagttgttagaatg
tttgttcaaagtgacaacttgccaatgattaaaccatttttgatttctgttttggataag
aacaattctgttgttaattctgcttaccatgatttattaattgaagaagaagattataaa
tctttgagatcatctattgaaaatgaaagcaacaatagattcaataaattggatttggct
gaaagattggaaaagcatgatttgattttctttagacaaattgctgctactttatacact
aaagaaaagaaattcaatagagccatttctattttgaaaactgataaattatggccagat
ttattaagaacagttgctatttccaaatctaaaaagattgctcatgaattattagattac
tttgttgaaacaggtaatcatgaatgttttgttgccttgttgtatacttcttatgaattc
attgctaatgattacgtgatggaattatcatggttgcacaacttgtccaactttattaaa
ccatatgagatttccattgcttttgaaaatcagaagaaattgaatgaagtataccaagat
ttacaaaagagaaaagaagcagatagaaaacaagaagaagaaccaggtgttggccaacca
ttgatgcttactaatggaccaatgagttatcaaggtactggtgccactggaattggttat
caaccaactggtactggatttggtaatgcattctag

DBGET integrated database retrieval system