KEGG   Candida albicans: CaO19.3507Help
Entry
CaO19.3507        CDS       T00189                                 

Gene name
MCR1
Definition
NADH-cytochrome b5 reductase
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cal  Candida albicans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CaO19.3507 (MCR1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CaO19.3507 (MCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 301 aa AA seqDB search
MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETGKTFTDSNEWVDLKLSK
SIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNVIRPYTPVSDVNQSGEIDF
VIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFKSIALIGGGTGITPLYQLLHQ
ITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKDQVKVHYFVDKADEKKWEGQIGF
ITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKVSPTDQGELTGALKDLGFEKEHVFK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgttgactcatcatttatcgaaattggctactccaaaattcttagtaccattcgctggt
gccactgctttgtcaattggtttggcattgcaatattctacttccaacaattacattgct
aacgaaactggtaaaactttcactgatagcaatgaatgggtggacttgaaattatctaag
tcaattgatttgactcataacaccaaacacttggttttcaagttaaaagatgagaatgat
gtttctggtttgatcactgcttcatgtttgttgaccaaatttgttacaccaaagggtaac
aatgttattcgtccatatacccctgtctctgatgttaaccaatctggtgaaattgatttc
gtgattaaaaaatacgacggaggtaaaatgtcaagtcacattttcgatttgaaagaaggt
gaaaccttatcattcaaaggaccaattgttaaatggaaatgggaaccaaatcaattcaag
tccattgctttgattggtggtggtactggtattactccattataccaattgttgcatcaa
atcacttctaatccaaaggacaacaccaaagttaatttgatttacggtaacttgactcca
gaagatatcttgttaaagaaagaaatcgatgctattgcttctaaacacaaggaccaagtt
aaagttcattactttgttgacaaggcagatgaaaagaaatgggaaggtcaaattggtttc
attactaaagaattcttacaaaaagaattagaaaaaccaggttctgatttcaaggttttt
gtttgtggtccaccaggtttatacaaggctatatcaggtcctaaagtttccccaactgat
caaggtgaattgactggtgctttgaaagatttgggtttcgaaaaagaacatgtctttaaa
ttttag

DBGET integrated database retrieval system