KEGG   Candida albicans: CaO19.3622Help
Entry
CaO19.3622        CDS       T00189                                 

Gene name
ANP1
Definition
Anp1 family member similar to S. cerevisiae Mannan 8; ER protein with a role in retention of glycosyltransferases in the Golgi
Orthology
K05533  
mannan polymerase II complex ANP1 subunit [EC:2.4.1.-]
Organism
cal  Candida albicans
Pathway
Various types of N-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, high-mannose type
Class
Metabolism; Glycan biosynthesis and metabolism; Various types of N-glycan biosynthesis [PATH:cal00513]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 428 aa AA seqDB search
MFYSLRTLIISIVIGIITLFTIYTQISNSKSGYAPNLSTFDTSQVQFYDLANYKGSANGW
QYDERVLFCVPLRDAAPHLPMFFSHMKNLTYPHNLIDLAFLVSDSKDDTMGELKRHLSEI
QKDPKLAFGEIEIFEKDFGQVIGQGFSDRHGFAAQGPRRKLMARARNWLWTVAVKPYHSF
VYWRDADVETVPPTILEDLMHHDKDVIVPNVWRPLPDWLGNQQPYDLNSWQESEGGLQLA
DTLDEDACIVEGYVEYQTWRPHLAYLRDPYGDPEVEMDLDGIGGVSILTKANVFRQGSHF
PAFSFEKHAETEAFGKLSKRMGFSVVGLPHYVIWHIYEPSSDDLKHMEWMASEEVRQQEE
AKIKKVYDKVWNKAFEDVQNNWDKERSKFLKNTDMSNVRKIKVDWSGVDDFDIDKNSHDD
KKLADFNP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttttattcactaagaacgttgattataagtattgttattggtataataactttattt
acaatttatacccaaatatctaattcaaaatcaggatatgctcctaatttatcaacattt
gatacttctcaagtccaattttatgatttggccaattataaaggttcagctaatggttgg
caatatgatgaacgagttttattttgtgttccattacgtgatgctgctcctcatttacca
atgtttttctctcatatgaaaaatttgacttatccacataatttaattgatttagcattt
ttagtttctgattctaaagatgatactatgggagaattaaaacgtcatttaagtgaaatt
caaaaagatcctaaattggcatttggagaaattgaaatttttgaaaaagattttggtcaa
gttattggtcaaggtttttccgatcgtcatggttttgctgctcaaggtccaagaagaaaa
ttaatggctagagcaagaaattggctttggacagtcgccgttaaaccatatcattcattt
gtttattggagagatgctgatgttgaaacggtaccaccaacaattttggaagatttaatg
catcatgataaagatgttattgtccccaatgtttggcgtcctcttcctgattggttaggt
aatcaacaaccatatgatttgaattcttggcaagaaagtgaaggaggtttacaattggcc
gatactttagatgaagatgcttgtattgttgaaggttatgttgaatatcaaacttggaga
cctcatttagcttatcttcgagacccttatggtgatcctgaagtagaaatggatttagat
ggtattggtggagtctctattttgactaaagcaaatgtattccgtcaaggatctcatttc
ccagcattttcatttgaaaaacatgcagaaactgaagcatttgggaaattaagtaaacga
atgggattttctgttgttgggttacctcattatgtgatttggcatatttatgaaccttca
tctgatgatttaaaacatatggaatggatggcatctgaagaagttcgtcaacaagaagaa
gctaaaattaaaaaagtttacgataaagtatggaataaagcttttgaagatgttcaaaat
aattgggataaagaaagaagtaaatttttgaaaaataccgatatgagtaatgtaaggaaa
attaaagttgattggtcaggagttgatgattttgatattgataaaaattctcatgatgat
aaaaaattagccgatttcaatccataa

DBGET integrated database retrieval system