KEGG   Candida albicans: CaO19.3815Help
Entry
CaO19.3815        CDS       T00189                                 

Gene name
UBP7
Definition
Ubiquitin-specific protease
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CaO19.3815 (UBP7)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CaO19.3815 (UBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 949 aa AA seqDB search
MERIKHKTRLPTANVNKSLPETPQPPSKPAPPNGMPRSQPQVFTTSTVGSSTVRHQFPKT
NTPPTAVMQPLITEDDMQAYYSRLINYEFRNLQLDSEVKSKSLFDLIDYCELQYETANVQ
LQTGATDPNATLKGIKTYIKGYLVFNYFINSFIMVHFKGFDTFIESNEQDFIIYLNIFAF
YNSNEYFQNGNYSIQSEDLREYVKKYLVDKNLLSFNIEELYSWLNEYITYLKEKDKSTEE
QASVSSSSSSFSFVEEVYAMPDLRQSTHSRNSSITSENEFKQKYPSIKRVDSPPSEFISK
QIPPPIPTQLPPSLLESITDLKSVSPNASPPSPTPTPPSPPPHRVSTSEYPISSDTFVTK
ERNRTSYPVQDNILGAAVPSEEQAYFQPKSYSRPKNEVPDGYLRPTDYTKTRMYHKSNNL
VSSNGNMNGYDPRLAQGHQIDSPIVQGSNVHFPPPPPQQQPIYHQPVQPIPYQPNMQLAQ
PIHQPYSYYQQPNQPIYHARNTQPQMYQPPAHYNNTHSHVPAHVVQQQEQIKHQKNSILK
EYFICGLRNFGSSCYINSTIQLLFGVYPFKSIFNHGYQKYVKDPKYLKILAKPNSHTKES
VLLSEAISGLLRTFQQNGGVSVSPTKFIRVTSLLKPDFNIPHEQQDAQEFLLFVLDRLHE
ELADKRQDNYDPELSVQKWRININMENKDKYMEWCKSLHEHEGSSPIMDLFQGHLQNKLK
CNKCGYESVSYSPFSILSLPIPNNYKNEVNLSDCLRYYIQDEVLSGENAWHCPKCNGEVQ
TLENHPVFENKRSGIFRLGGKKKHTKSQQTQNNSTNTISTKSINFVKLPTILFIHLSRFS
MYNLTDKLDTMIKYPLLLKFNNQGHEIVYKLTGMINHFGNLKSGHYTSLVNKSTVHEKLQ
NSDNLKRPCWCLFDDEHVRSNLAHGALNHPHDELVSRDVYVLCYERIDV
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcataaagcacaagacgagactacctacagcaaatgtgaataaaagtttgcct
gagacaccacagcctccttccaagccagcgccacccaatggtatgccaagatctcaacct
caagtttttactacttcaacagttggatcaagcactgtgcgacatcagtttccaaaaacc
aatactccaccaactgctgtaatgcagccactaataacagaagatgacatgcaagcatac
tatagtcggttgatcaactatgagttcagaaacttgcaactagactccgaagtaaaatcg
aaatcattatttgatctaatagattattgtgaattgcagtacgaaacggcgaatgtccaa
cttcaaacgggagcaacagaccctaatgccacattgaagggaatcaaaacttacataaaa
ggttatcttgtttttaattattttataaacagttttatcatggtgcatttcaaaggcttt
gatacgtttattgaaagcaacgagcaagattttataatatatttgaatatttttgcattc
tataactcgaacgagtattttcaaaatggaaattactctattcagtcggaagatttgcgg
gaatatgtcaagaagtatctcgtggacaaaaacctattaagcttcaacatcgaggaattg
tactcttggctcaacgaatatatcacgtatttgaaagaaaaagacaaatcgacagaagaa
caagcttccgtatcctcatcaagctcatcattctcgtttgttgaagaagtgtacgctatg
ccagatcttcgccaatcgacacattctagaaattcatccataacctcagaaaatgagttt
aagcagaaatatccctctatcaaaagagttgattcgcctccttcagaatttatatcgaaa
cagataccaccgccaataccgacacagttgccacctagtttgcttgaatcaataacagac
ttgaaatctgtgtctccaaatgcatctccaccttcgcctacaccaacacccccgagtcct
cctccacatcgtgtttccacatcagaatatcccatttcaagtgacacgttcgtaacaaaa
gaaagaaatagaacctcttatcctgtccaagacaatattttaggtgcagctgttccctct
gaggaacaagcttatttccaaccaaagtcttatagcagacccaagaatgaagttccagat
ggttatcttcgaccaacagactacacaaaaactcgaatgtaccataaatcaaataatcta
gtctcttccaacggtaatatgaatggttatgatccgaggcttgcacaaggtcatcagatc
gactcaccaatagttcaaggcagtaatgtacattttccaccaccaccaccacaacaacaa
cctatttatcaccaaccagtacaaccaataccgtaccaaccaaacatgcagctagcgcaa
ccaatccaccaaccgtattcttattaccaacaaccaaatcaaccgatctatcatgctcga
aatactcaaccccaaatgtaccaaccaccagcacattataacaatacacattcccacgtg
cctgcacatgttgtacaacagcaagaacaaataaagcaccagaaaaattcgatattgaag
gaatacttcatttgtgggctaaggaattttggttcctcatgctacatcaactccaccatt
cagttgttgtttggcgtttacccttttaaatccattttcaaccacggatatcagaagtat
gtgaaggaccctaagtatttgaaaatacttgccaaacctaatagccacacaaaagaatct
gtgctattaagtgaagctatatctggactcttgaggactttccaacagaacggtggtgtg
tcggtttcccccaccaagtttattcgagtgacttcattattaaagccagatttcaatatt
ccacatgagcaacaagacgcacaagagtttttgctatttgttttggatagactacatgag
gaattggcagataaacgacaagacaactatgacccggagttgtctgtccagaaatggagg
ataaatatcaacatggagaataaggacaagtacatggagtggtgcaaatcattacatgaa
cacgaaggtagctcgccaatcatggatttgttccagggtcacttgcagaacaaattgaaa
tgcaacaaatgtgggtatgaatcagttagctattctccgttcagtattttatcattacct
ataccaaacaattacaaaaatgaagtcaacttaagcgattgcttacgatattatatccaa
gatgaagtgttatcaggagagaatgcatggcactgtcctaaatgtaacggcgaggtccag
acattagaaaaccacccagtttttgaaaataaacgatcaggtattttcaggctaggcggg
aagaaaaaacacaccaagagccaacagacgcaaaacaacagtacaaataccatctccacc
aagagtatcaactttgttaagttaccaacaatcttattcattcatttgtcccgattttcc
atgtacaatttaacagataaattagatacaatgattaaataccctttgttattaaaattc
aacaaccagggccacgagatcgtttataaattaacaggtatgatcaaccattttggtaat
ttgaagagtgggcactatacttctttagttaacaagtccacggttcatgaaaagttgcag
aactcagataatttgaaacgcccatgttggtgtttatttgacgatgaacatgttcgttca
aatttggcacatggagctttaaatcatccacacgatgaattggtgtctagagatgtttat
gttttgtgttatgaaagaatagatgtatag

DBGET integrated database retrieval system