KEGG   Candida albicans: CaO19.3920Help
Entry
CaO19.3920        CDS       T00189                                 

Gene name
MPD1
Definition
potential protein disulfide isomerase similar to S. cerevisiae MPD1 (YOR288C)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cal  Candida albicans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CaO19.3920 (MPD1)
Enzymes [BR:cal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CaO19.3920 (MPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 299 aa AA seqDB search
MIFNYLLALFQILVLASARAQADEYASDPNIFELTPSNFDKVVHKSNYTTLVKFYAPWCG
YCQKLQPVYHKLGKYINKDAKYSINIASVNCDKDYNKQLCSQYQVRGFPTLMVFRPPKYE
KGKQVKLQKHASEVYQGERTVKSITKFLTSRLKNYVKKFHNIRSDGIAEWLAEDIPSVLL
ISNANSVSPLLKSIAIDFLDRVNVGMISKFNDESHKFVIGDKEIEVPATSKSSLFYFNKE
KGELVAYTKSDKLNDKIKITEWIIEQTQQQPIEGPLSKKEKKYYYKYRTGKKKIEHDEL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattttcaactacttgttggcattgtttcaaattcttgttttagcctctgctagagct
caggcagatgaatatgcgtcagacccaaatattttcgagttgacgccttcaaattttgac
aaagtggttcacaagtcgaattacactactttggtaaagttttacgccccttggtgtgga
tactgtcagaaattacaaccagtataccataaattgggcaaatacatcaataaagatgca
aagtattccatcaatattgctagtgtaaattgtgataaggattacaataaacagttgtgt
tcacaataccaagttcgaggatttcccacattaatggtgttcagacctcctaaatacgaa
aaggggaaacaagtaaagttgcagaaacatgccagtgaagtttatcaaggtgagagaact
gtcaagtcaatcaccaagtttttaacttcaagattgaaaaattatgtgaaaaagtttcac
aacatcagaagtgatggtattgctgaatggttggcagaagatataccttctgttttactt
atttccaatgcaaatctggttagtccattgttgaaatccatagccattgattttcttgac
cgtgtcaacgtcggaatgatatccaaatttaatgatgagtcgcataaatttgttattggc
gataaagaaattgaagttccagctacctccaaatcgagcttgttctattttaataaggaa
aagggagagttggtggcttatactaaatctgacaaattaaatgacaagatcaaaataact
gaatggataatagaacaaacccagcaacaaccaatagagggcccattatccaagaaggaa
aagaagtattactacaaatatagaacaggaaaaaagaaaatagaacatgacgaattatag

DBGET integrated database retrieval system