KEGG   Candida albicans: CaO19.3930Help
Entry
CaO19.3930        CDS       T00189                                 

Gene name
UCT99
Definition
ubiquitin carboxyl-terminal hydrolase-like protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CaO19.3930 (UCT99)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CaO19.3930 (UCT99)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 185 aa AA seqDB search
MIGETISNSDLIRSIHNSFSAPHSFVDEDKPPPPPDRDDKDDGLFHFVGYIFKQGKIYEL
DGLKQYPISHGECSGQDEFIQKLPTIVQERISKYGNELRFSLLAVTNNKLEQAQAMGDQE
EIASQLHKRELWKKENELRKHDYTGLIVQLLKNISKEKSDKEWEDFLQKGRNKTQQLIAQ
SIKKT
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgataggagaaacaatctccaatagtgatttaatcagatctatccataattctttcctg
gctccacattcatttgttgacgaagacaaacctccaccacctccagatagagatgacaaa
gatgatggattatttcattttgtagggtacattttcaaacaggggaaaatctatgaattg
gatgggttgaaacaatatccaatttctcatggtgaatgtagtggacaagatgaatttatt
caaaaactacctacaattgtacaagagcgtatatcaaagtatggtaacgagttgaggttc
tcgttgttggcagtcaccaataacaaattggaacaagcacaagctatgggcgaccaagag
gaaattgcaagtcaattacataaacgtgaactttggaaaaaagaaaacgaattgcgtaaa
cacgattacactgggttgatagtccagttattgaagaatataagcaaagaaaaaagcgat
aaagaatgggaagactttttacagaaaggaagaaataagacgcaacaactcattgcccaa
tcaataaagaaaacataa

DBGET integrated database retrieval system