KEGG   Candida albicans: CaO19.3934Help
Entry
CaO19.3934        CDS       T00189                                 

Gene name
CAR1
Definition
likely arginase similar to S. cerevisiae CAR1 (YPL111W) involved in arginine catabolism to ornithine
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cal  Candida albicans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.3934 (CAR1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CaO19.3934 (CAR1)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CaO19.3934 (CAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 317 aa AA seqDB search
MSSIQYKYHPDKKASIITAPFSGGQPKGGVELGPDYILKAGFQKQIESLGWTTDLKEPLE
GTDYEKMKTNDKDDFGVKNSKIVSESCQKIHDAVKGSLAEGKLPITIGGDHSIGTATVSA
SLVHDPSTCVVWVDAHADINTPKTTDSGNLHGCPLSFIMGIDRDSYPPEFSWVPQVLKSN
KLVYIGLRDVDDGEKEILRKHNIAAFSMYHVDKYGIGKVVEMALDKVNPNRDCPVHLSYD
VDAIDPSFVPATGTRVEGGLSLREGLFIAEEIAQSGLLQSLDIVETNPMLAETEEHVLDT
VSAACAIGRCALGQTLL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaattcaatataaatatcatccagacaaaaaagcttctataataacagcacca
ttttcaggcggtcaaccaaaaggtggtgtagaattgggtcctgattatattctcaaagct
ggtttccaaaaacaaattgaatctttaggatggacgactgatttaaaggaaccattggaa
ggtactgattacgaaaaaatgaaaactaatgataaggacgattttggtgttaagaattca
aaaattgtcagcgaatcttgtcaaaaaattcatgatgctgtcaagggaagtttggcagaa
ggtaagttgccgattaccattggtggtgatcactctattggaactgctactgttagtgca
agtttggtacacgatccatctacttgtgtcgtttgggttgatgctcatgctgatattaac
actccaaaaaccactgattcaggcaatttacacggttgtccattgagttttatcatgggt
atcgatagagacagctacccaccagaattttcttgggtgcctcaagtattaaaatccaac
aaattggtttatatcgggttaagagatgttgatgatggagaaaaggaaattttacgtaaa
cacaacattgcagccttttcaatgtatcacgttgacaaatatggaataggaaaagttgtt
gaaatggccttggacaaagttaatccaaatcgcgattgtccagtacatttgtcctatgat
gttgatgctattgacccatcattcgttccagctacaggtactagagttgaaggagggttg
tcgttgagagaaggtttgtttattgctgaagagattgctcaaagtggacttttacaaagt
ttggatatagtggagactaacccaatgttagctgaaactgaagaacatgtattggatact
gtcagtgcagcatgcgctataggtagatgtgcattgggtcaaactttattgtaa

DBGET integrated database retrieval system