KEGG   Candida albicans: CaO19.3957Help
Entry
CaO19.3957        CDS       T00189                                 

Gene name
FOL2
Definition
GTP-cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CaO19.3957 (FOL2)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CaO19.3957 (FOL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 276 aa AA seqDB search
MSNPSHNPKHHLREEDSNGTQDGPKSTVPIKRSKLVGSSNLVSPNFLPRDLIETPLQTRA
ASPLTLNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAVKVILEELGEDTSREGL
LETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK
AHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATHM
CMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEVLTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacccatcacataatccaaaacatcatcttcgtgaagaagattccaatggaact
caagatggaccaaaatcaactgtacctatcaaaagatctaaattggttggctcatccaat
ttagtatctccaaattttttacctagagatttaatagaaactccattgcaaacacgtgct
gcatctccattgactttaaacccaccaattgatagcgatggattatcatggccatctcaa
ggagcaagacttagaatagagcaaacctcagaagaagctaaagccagagaagaacgtatt
gcctcggccgtaaaagtaatcttggaagaattgggcgaggacacttcacgtgaaggatta
ttagaaacacctgaacgatatgctcgtgccatgttatatttcacaaaaggatatgaagat
aatattagggatgttattaaaagagcagtttttgaagaagatcatgatgaaatggttatt
gttagagatattgagatttattcactttgtgaacatcatttagttccatttttcgggaaa
gctcatattgcatatattccaaataaaagagttttaggtttaagtaaattggcaagattg
gcagaaatgtattcaagaagatttcaggttcaagaaagactaaccaaacaaattgccatg
gcattaagtgaaatcttgaaaccaagaggtgttgcagtagtcattgaagccactcatatg
tgtatggtcagtagaggggttcaaaaaactggctcttcaactactacaagttgtatgttg
ggttgtttccgtgatcaacaaaaaaccagagaagaggtcttaacatattag

DBGET integrated database retrieval system