KEGG   Candida albicans: CAALFM_C504720CAHelp
Entry
CAALFM_C504720CA  CDS       T00189                                 

Gene name
CaO19.3957
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAALFM_C504720CA (CaO19.3957)
Enzymes [BR:cal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CAALFM_C504720CA (CaO19.3957)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 272 aa AA seqDB search
MSNPSHNPKHHLREEDSNGTQDGPKSTVPIKRSKLVGSSNLVSPNFLPRDLIETPLQTRA
ASPLTLNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAVKVILEELGEDTSREGL
LETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK
AHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATHM
CMVSRGVQKTGSSTTTSCMLGCFRDQQKTREE
NT seq 817 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacccatcacataatccaaaacatcatcttcgtgaagaagattccaatggaact
caagatggaccaaaatcaactgtacctatcaaaagatctaaattggttggctcatccaat
ttagtatctccaaattttttacctagagatttaatagaaactccattgcaaacacgtgct
gcatctccattgactttaaacccaccaattgatagcgatggattatcatggccatctcaa
ggagcaagacttagaatagagcaaacgtcagaagaagctaaagccagagaagaacgtatt
gcctcggccgtaaaagtaatcttggaagaattgggcgaggacacttcacgtgaaggatta
ttagaaacacctgaacgatatgctcgtgccatgttatatttcacaaaaggatatgaagat
aatattagggatgttattaaaagagcagtttttgaagaagatcatgatgaaatggttatt
gttagagatattgagatttattcactttgtgaacatcatttagttccatttttcgggaag
gctcacatcgcatatatcccaaataaaagagttttaggtttaagtaaattggcaagattg
gcagaaatgtattcaagaagatttcaggttcaagaaagactaaccaaacaaattgccatg
gcattaagtgaaatcttgaaaccaagaggtgttgcagtagtcattgaagccactcatatg
tgtatggtcagtagaggggttcaaaaaactggctcttcaactactacaagttgtatgttg
ggttgtttccgtgatcaacaaaaaaccagagaagagt

DBGET integrated database retrieval system