KEGG   Candida albicans: CaO19.3957Help
Entry
CaO19.3957        CDS       T00189                                 

Gene name
FOL2
Definition
GTP-cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cal00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 276 aa AA seqDB search
MSNPSHNPKHHLREEDSNGTQDGPKSTVPIKRSKLVGSSNLVSPNFLPRDLIETPLQTRA
ASPLTLNPPIDSDGLSWPSQGARLRIEQTSEEAKAREERIASAVKVILEELGEDTSREGL
LETPERYARAMLYFTKGYEDNIRDVIKRAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGK
AHIAYIPNKRVLGLSKLARLAEMYSRRFQVQERLTKQIAMALSEILKPRGVAVVIEATHM
CMVSRGVQKTGSSTTTSCMLGCFRDQQKTREEVLTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacccatcacataatccaaaacatcatcttcgtgaagaagattccaatggaact
caagatggaccaaaatcaactgtacctatcaaaagatctaaattggttggctcatccaat
ttagtatctccaaattttttacctagagatttaatagaaactccattgcaaacacgtgct
gcatctccattgactttaaacccaccaattgatagcgatggattatcatggccatctcaa
ggagcaagacttagaatagagcaaacctcagaagaagctaaagccagagaagaacgtatt
gcctcggccgtaaaagtaatcttggaagaattgggcgaggacacttcacgtgaaggatta
ttagaaacacctgaacgatatgctcgtgccatgttatatttcacaaaaggatatgaagat
aatattagggatgttattaaaagagcagtttttgaagaagatcatgatgaaatggttatt
gttagagatattgagatttattcactttgtgaacatcatttagttccatttttcgggaaa
gctcatattgcatatattccaaataaaagagttttaggtttaagtaaattggcaagattg
gcagaaatgtattcaagaagatttcaggttcaagaaagactaaccaaacaaattgccatg
gcattaagtgaaatcttgaaaccaagaggtgttgcagtagtcattgaagccactcatatg
tgtatggtcagtagaggggttcaaaaaactggctcttcaactactacaagttgtatgttg
ggttgtttccgtgatcaacaaaaaaccagagaagaggtcttaacatattag

DBGET integrated database retrieval system