KEGG   Candida albicans: CaO19.3997Help
Entry
CaO19.3997        CDS       T00189                                 

Gene name
ADH1
Definition
immunogenic alcohol dehydrogenase; similar to S. cerevisiae ADH3 (YMR083W); has an N terminal extension compared to database sequences (AAA53300 and CAA57342); aka CAD
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cal  Candida albicans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CaO19.3997 (ADH1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CaO19.3997 (ADH1)
  Lipid metabolism
   00071 Fatty acid degradation
    CaO19.3997 (ADH1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CaO19.3997 (ADH1)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CaO19.3997 (ADH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 434 aa AA seqDB search
MQASLFRIFRGASLTTTTAAASFTATATAGATTAKTLSGSTVLRKSYKRTYSSSVLSSPE
LFFFHQFNNNKRYCHTTTTTNTKTIMSEQIPKTQKAVVFDTNGGQLVYKDYPVPTPKPNE
LLIHVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDFAGIKW
LNGSCMSCEFCQQGAEPNCGEADLSGYTHDGSFEQYATADAVQAAKIPAGTDLANVAPIL
CAGVTVYKALKTADLAAGQWVAISGAGGGLGSLAVQYARAMGLRVVAIDGGDEKGEFVKS
LGAEAYVDFTKDKDIVEAVKKATDGGPHGAINVSVSEKAIDQSVEYVRPLGKVVLVGLPA
HAKVTAPVFDAVVKSIEIKGSYVGNRKDTAEAIDFFSRGLIKCPIKIVGLSDLPEVFKLM
EEGKILSRYVLDTS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaagcttattcagaattttcagaggtgcgagtctcaccactaccactgcagct
gcatcttttacagcaacagcaacagcaggtgccaccacggcaaagacattgtctggatcc
actgtgctccgaaaactgtataaaaggacctattcatccctggtcttatcttctccagaa
ttatttttttttcatcagtttaacaacaacaaacgttattgtcatacaacaacaacaaca
aatacaaaaacaattatgtctgaacaaatcccaaaaactcaaaaagccgttgtctttgat
accaatggtggtcaattagtctacaaggattacccagttccaactccaaagccaaatgaa
ttgttgattcacgtcaaatactctggtgtctgtcacactgatttacatgcttggaaaggt
gactggccattggctactaaattgccattagttggtggtcacgaaggtgccggtgtcgtt
gtcggtatgggtgaaaacgtcaaaggatggaaaatcggtgactttgccggtatcaaatgg
ttgaacggttcttgtatgagttgtgaattctgtcaacaaggtgctgaaccaaactgtggt
gaagctgacttgtctggttacactcacgatggttcattcgaacaatacgctactgctgat
gctgtccaagccgctaaaattccagctggtactgatttagccaatgtcgcaccaatctta
tgtgctggtgttactgtttacaaagccttaaagactgctgacttagcagctggccaatgg
gttgctatctccggtgctggtggtggtttaggttctttggccgttcaatacgccagagcc
atgggtttgagagttgttgctattgacggtggtgacgaaaaaggtgaatttgtcaaatca
ttgggtgctgaagcttacgttgatttcaccaaagataaagatattgttgaagctgttaag
aaggctactgatggtggtccacacggtgctatcaatgtctctgtttctgaaaaagctatt
gaccaatctgttgaatatgttagaccattaggtaaagttgttttggttggtttaccagct
cacgctaaagtcactgctccagttttcgatgctgttgtcaaatccattgaaatcaaaggt
tcttacgttggtaacagaaaagatactgctgaagctattgacttcttctccagaggttta
atcaaatgcccaatcaagattgtcggtttatctgacttgccagaagtcttcaaattgatg
gaagaaggtaaaatcttgagtagatacgtattggacaccagttga

DBGET integrated database retrieval system