KEGG   Candida albicans: CaO19.4009Help
Entry
CaO19.4009        CDS       T00189                                 

Gene name
CNB1
Definition
Calcineurin regulatory (B) subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 201 aa AA seqDB search
MSIHNYTTPNRILYYNYQYIRLQQLSTKMGANASILDGFIEDTNFSIEEIDRLRKRFMKL
DKDGSGQIDKQEFLSIPGISSNPLATRLMDVFDKDGDGSIDFEEFITGLSAFSGKSDNLN
KLRFAFNIYDIDRDGYIGNGELFIVMKMMVGKNLKDEELQQIVDKTLMEADLDGDGKLNF
EEFKNAVNTDTIANTLTLNMF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcataattacacgactccaaatcgtatactttactacaactaccagtacatt
cgacttcaacaactactgacaaaaatgggggctaacgcaagtattcttgatggtttcatc
gaagataccaattttagtattgaagagattgatagattgcgcaagaggtttatgaaatta
gataaagatgggtcagggcaaattgataagcaagaatttttatccatacctggtattagt
tcgaatccattagccaccagattgatggatgtgtttgataaagatggagatggatcgatt
gattttgaagagtttattactggattatctgcattttctgggaaatcagataatttaaac
aaattaagatttgcatttaatatatacgatattgatcgtgatgggtacattggaaatggt
gagctatttattgtgatgaaaatgatggttggtaaaaatttgaaggacgaggaactacaa
caaatagtggataagactttaatggaagctgatttggacggtgatggcaagttgaatttt
gaagaatttaaaaatgcagtcaacaccgatacaattgccaacactttgacattaaatatg
ttctga

DBGET integrated database retrieval system