KEGG   Candida albicans: CaO19.4233Help
Entry
CaO19.4233        CDS       T00189                                 

Gene name
THR4
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cal  Candida albicans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.4233 (THR4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CaO19.4233 (THR4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CaO19.4233 (THR4)
Enzymes [BR:cal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CaO19.4233 (THR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 510 aa AA seqDB search
MPSSSQVYRSTRSSQPEELSFEDVVMTGLAPDGGLYLPSAIPQLPKDFLSKWTDLSFNEL
AFEILRLYINENEIPNADLKDLITRSYSTFRSSEVTPLKKLDDNLYILELFHGPTYAFKD
VALQFVGNLFEYFLTRRNAQKDLTKQPRDIITVVGATSGDTGSAAIYGLRGKKDVSVFIL
YPTGRISPIQEEQMTTVEDENVHTLSVNGTFDDCQDIVKSVFGDKEFNDKYHVGAVNSIN
WARILAQQTYYFYSYFQLQKQAKTTNKVRFVVPSGNFGDILAGYYAYRMGLPVDKLIIAT
NENDILDRFIKSGEYAKEQEVGVKATYSPAMDILISSNFERLLWYLIRDNAPEVNKSDEK
AGQLLNDWMKQLKEQGKFKVPAEVIDAARQVFDSQRVDNDTTVQTIKQVYDKSADKYVID
PHTAVGVTTSYSFIAKDTEPIQYISLSTAHPAKFSEVVNKALDSFDGYSFDKDVLPAELK
ALSSKEKRIKLIDEASVEKVKQAIKDELKF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgccttcctcatcacaagtttatagatctactagatctagccaaccagaagaattatcc
tttgaagatgttgttatgactgggttagctcccgatggtggattgtatttaccatcagct
atccctcaattacctaaggactttttaagtaaatggactgacttatcatttaatgaattg
gcatttgagatattaagattatatatcaatgagaatgaaatccctaatgccgatttgaaa
gatttgattaccagatcatactcaacattcagatcatcagaagtgactccattgaaaaaa
cttgatgacaatttatacattttggaattatttcatggtcctacttatgcattcaaagat
gttgctttacaatttgtcggtaatctttttgaatatttcttaactagaagaaatgcacaa
aaggatttgactaaacaaccaagagatatcattaccgttgttggtgccacctcaggtgat
actggatcagctgccatttatgggttacgtggtaagaaagacgtatctgtatttatatta
tatcctaccggaagaatcagtccaatacaggaagaacaaatgaccactgttgaagatgaa
aatgtccatactttatcagtcaatggtacctttgatgattgtcaagatattgtcaaactg
gtatttggagacaaagaatttaatgataaatatcatgttggggctgtcaactctatcaat
tgggccagaattttggcacaacaaacatattatttctattcttatttccaattacagaag
caagctaaaactactaataaagtcagatttgttgttccttcgggtaatttcggagatatt
ttggctggttattatgcttacagaatgggattaccagttgacaaattgattattgccacc
aacgaaaacgacatcttggacagatttataaagtcaggtgaatacgccaaggaacaagaa
gttggtgtcaaggcaacttattctccagcaatggatattttgatctcatcgaattttgaa
agattgttatggtacttaatcagagacaacgctcctgaagttaacaagagtgacgaaaaa
gccggtcaattattgaatgattggatgaaacagttgaaagaacaaggcaaattcaaagtc
ccagctgaggtcattgatgcagcaagacaagtttttgattcacaaagagttgataatgac
actaccgtacaaaccatcaaacaagtgtacgacaagtctgctgataaatatgtcattgat
cctcacactgctgttggtgtcactacttcttattcatttattgctaaagatacagagcca
attcaatacatttctctttccactgctcatccagccaaattctccgaggttgtcaataag
gctcttgattcatttgatggttactcatttgacaaagatgtcttgcctgcagaattgaaa
gctttgagcagtaaagagaagagaattaaattgattgatgaagctagtgttgaaaaagtc
aaacaagccattaaagatgaattgaaattttag

DBGET integrated database retrieval system