KEGG   Candida albicans: CaO19.4436Help
Entry
CaO19.4436        CDS       T00189                                 

Gene name
GPX2
Definition
similar to S. cerevisiae GPX2 (YBR244W) phospholipid hydroperoxide glutathione peroxidase; one of four potential glutathione peroxidase genes
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cal  Candida albicans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CaO19.4436 (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CaO19.4436 (GPX2)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CaO19.4436 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 171 aa AA seqDB search
MGNELLSTARIYTFKIPDAYNNVIDFDQFKNKVILIVNVASLCGFTPQYKELQLLYEKYH
ERGLEILGFPCNQFGNQEPLQEEEIVESCRRNFGVSFPIMKKTKVNIDCDGHESELYKYL
KSEKPGEVGFKGVRWNFEKFIVNRKGEVVARFNSLITPLQLEGFIEQLLSE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgagttattatcaaccgcaagaatatacacgttcaaaatacccgatgcatat
aataatgtgatagatttcgaccaattcaagaataaagtgatactaatagtcaatgtggca
agtttgtgtgggttcacacctcaatataaagaattgcaattgctttacgaaaaatatcat
gaacgtggtctagaaatattaggatttccttgtaatcaatttggaaatcaagaaccactt
caggaagaagaaatagtcgaatcttgtagacgcaattttggtgtcagtttccccataatg
aagaaaaccaaagttaatatagattgtgatggccatgagtcggaattgtacaagtacttg
aaatctgaaaagcctggtgaagtgggttttaaaggtgtccgttggaattttgaaaagttt
atagtgaacagaaaaggtgaagttgttgctagatttaactctctaataacaccactacaa
ctcgaagggtttattgaacaacttttatcagaataa

DBGET integrated database retrieval system