KEGG   Candida albicans: CAALFM_C101820CAHelp
Entry
CAALFM_C101820CA  CDS       T00189                                 

Gene name
CaO19.4542
Definition
(RefSeq) TFIIH complex kinase subunit
  KO
K06634  
cyclin H
Organism
cal  Candida albicans
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CAALFM_C101820CA (CaO19.4542)
  Replication and repair
   03420 Nucleotide excision repair
    CAALFM_C101820CA (CaO19.4542)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CAALFM_C101820CA (CaO19.4542)
DNA repair and recombination proteins [BR:cal03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CAALFM_C101820CA (CaO19.4542)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 395 aa AA seqDB search
MSEVKNELETETTPAPAKKQRLSNDDLYRNSTQYELWSFTQETLQDAKREANEKGVKISK
ERFKSAFENAKKEHPDAFEQFPDELNENMVSLLTLEEESTYLDFYIQNITTTCNFFKMPT
QVRLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTDTSHI
LDLEFIVLQSLKFTLLVHHPIRALYGFFLDFQAVLLHPEQVMYDVSVDTLGNMYNQAKEW
LNKYFMVSDVAFLFTPPQIALAAMYDTDKRITDKYLRRKYLGNEEKLDPIKEQENENEKQ
NGEDKSVVASEEASKDVSKEKTKSSNRQQYETLVTLLRKCVKLAKQSRVADREASKEIDK
KCFFALNPKKLIDKRIKRLTLGNQDVAKESTVEPS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtaaagaatgaattggagacagagacgactccagcaccagctaagaagcaa
agactatcaaatgatgacttgtatcgaaattcaactcaatacgagttatggtcatttacc
caagaaacattacaagatgccaaacgagaggcaaatgaaaagggggtcaaaatttcaaaa
gagagattcaaatctgcctttgagaatgcaaagaaagaacatccagatgcttttgaacaa
tttccagatgaattgaacgaaaatatggtcagtctattaacactagaagaagaatccacc
tatcttgatttttacatacaaaacattactacgacatgtaatttttttaaaatgccaact
caagttcgattaacagctgcttcatttttcaagaaattttacctagtcaactccgtaatg
gaatttcatcctaaaaatgtattatatacatgtatatttctagctgcaaagtcggaaaat
tatttcatctcgatagagtcatatgttaaggcattaaagggaacagatacatctcatatt
ctagatttggagttcattgtgttgcagagtttgaagtttacattgttggtacatcatcca
atacgagcattatatgggtttttcctagattttcaagctgtattattacatccagaacaa
gtgatgtatgatgtatcagtagatactttggggaacatgtataatcaagcaaaggaatgg
ctcaataagtattttatggtcagcgatgtggcgtttttgtttacgccgccgcagattgca
cttgcagcaatgtacgatactgataaaaggattactgataaatacttgagacgaaaatat
cttggcaatgaggaaaagttggatccgataaaagaacaggagaatgaaaatgaaaaacaa
aatggcgaagataaatctgtagttgcatcagaagaagcttcaaaggatgttagcaaggaa
aagactaaatcttccaatagacagcaatatgaaacattggttacattattgagaaagtgt
gtaaaacttgcgaaacagtcacgggttgctgatcgtgaagcaagtaaggaaattgataag
aaatgtttctttgcattaaatccgaaaaaattaattgataaacgtatcaaaagattaact
ttggggaatcaggatgttgcgaaagaaagtacagttgaacctctgtaa

DBGET integrated database retrieval system