KEGG   Candida albicans: CaO19.4542Help
Entry
CaO19.4542        CDS       T00189                                 

Gene name
CCL1
Definition
cyclin
Orthology
K06634  
cyclin H
Organism
cal  Candida albicans
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:cal00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CaO19.4542 (CCL1)
  Replication and repair
   03420 Nucleotide excision repair
    CaO19.4542 (CCL1)
Transcription machinery [BR:cal03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CaO19.4542 (CCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 395 aa AA seqDB search
MSEVKNELETETTPAPAKKQRLSNDDLYRNSTQYELWSFTQETLQDAKREANEKGVKISK
ERFKSAFENAKKEHPDAFEQFPDELNENMVSLLTLEEESTYLDFYIQNITTTCNFFKMPT
QVRLTAASFFKKFYLVNSVMEFHPKNVLYTCIFLAAKSENYFISIESYVKALKGTDTSHI
LDLEFIVLQSLKFTLLVHHPIRALYGFFLDFQAVLLHPEQVMYDVSVDTLGNMYNQAKEW
LNKYFMVSDVAFLFTPPQIALAAMYDTDKRITDKYLRRKYLGNEEKLDPIKEQENENEKQ
NGEDKSVVASEEASKDVSKEKTKSSNRQQYETLVTLLRKCVKLAKQSRVADREASKEIDK
KCFFALNPKKLIDKRIKRLTLGNQDVAKESTVEPS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtaaagaatgaattggagacagagacgactccagcaccagctaagaagcaa
agactatcaaatgatgacttgtatcgaaattcaactcaatacgagttatggtcatttacc
caagaaacattacaagatgccaaacgagaggcaaatgaaaagggggtcaaaatttcaaaa
gagagattcaaatctgcctttgagaatgcaaagaaagaacatccagatgcttttgaacaa
tttccagatgaattgaacgaaaatatggtcagtctattaacactagaagaagaatccacc
tatcttgatttttacatacaaaacattactacgacatgtaatttttttaaaatgccaact
caagttcgattaacagcagcttcatttttcaagaaattttacctagtcaactccgtaatg
gaatttcatcctaaaaatgtattatatacatgtatatttctagctgcaaagtcggaaaat
tatttcatctcgatagagtcatatgttaaggcattaaagggaacagatacatctcatatt
ctagatttggagttcattgtgttgcagagtttgaagtttacattgttggtacatcatcca
atacgagcattatatgggtttttcctagattttcaagctgtattattacatccagaacaa
gtgatgtatgatgtatcagtagatactttggggaacatgtataatcaagcaaaggaatgg
ctcaataagtattttatggtcagcgatgtggcgtttttgtttacgccgccgcagattgca
cttgcagcaatgtacgatactgataaaaggattactgataaatacttgagacgaaaatat
cttggcaatgaggaaaagttggatccgataaaagaacaggagaatgaaaatgaaaaacaa
aatggcgaagataaatctgtagttgcatcagaagaagcttcaaaggatgttagcaaggaa
aagactaaatcttccaatagacagcaatatgaaacattggttacattattgagaaagtgt
gtaaaacttgcgaaacagtcacgggttgctgatcgtgaagcaagtaaggaaattgataag
aaatgtttctttgcattaaatccgaaaaaattaattgataaacgtatcaaaagattaact
ttggggaatcaggatgttgcgaaagaaagtacagttgaacctctgtaa

DBGET integrated database retrieval system