KEGG   Candida albicans: CAALFM_CR05980WAHelp
Entry
CAALFM_CR05980WA  CDS       T00189                                 

Gene name
CaO19.457
Definition
(RefSeq) ubiquitin-specific protease
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
cal  Candida albicans
Brite
Enzymes [BR:cal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CAALFM_CR05980WA (CaO19.457)
Peptidases [BR:cal01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CAALFM_CR05980WA (CaO19.457)
Ubiquitin system [BR:cal04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CAALFM_CR05980WA (CaO19.457)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
R
AA seq 1304 aa AA seqDB search
MMDNEATIPSSLASTEAENVDTETGNSDKSLSHINRSSNFPETTSNQLQSNNPFRSSTST
VSVPSSESVPISQLRTRIANAELVNYPFKTLNRILDDLKWTIPVQEKYNFSMLNSKPIDY
SEELSKVVNSSVIHFETLILNNDLEYCKSVEKVEYSNSQQVLYIMRGILSDKKHGTYHFR
LAALETDSNPFVTKLIDKHQYHVIPKSSISAHDLQILLENTIDVDKIIDDAFFKSLNSPN
GQILRVTLFKAEFTQEDLVPLTDEEIIRERYLEGIKRHPNLSPETIPNQLHCIKTLIKVL
RGPVTLKPEDTIKTINLKNTVMDAQIDVNLLFEKLSFTLNGDEAVPPDLNNLPDLKESYI
RKILELIFFAKNVMVPNNEFQTLYSFSDNMSQVFHTIVEYDKNVSVRHFSSNYSNRFPYF
INLSASAYFSDELIIKCFELTVQSDSINQLYYVDSLKQIRSFRNNNGGYSVNNKLDIYFR
QRNLIGYSDFLESMKILGLAVESNETETIDDDVIIAMYRSQFKNDPKNYQYYNNHLKRIA
GIKNSEKLDDFIQKELLPIDLALEELSIEEITEDDVVITAYEFKLDELLQSNGFNGNANE
VIFLNKALLSVAVHRRSYILLEYLETKLPDYVKIPTMNEMTTRKAFETLDIDVQASESEI
ISNFQNKFLKGNVDIRLLRYALKLIAESKKSEILLSFLRTGKIDTSLLPAQNWPAGLDNI
GNTCYLNSLLQYYFCIKPLRELILTFNENNFSANDYPETRKIGGRKVENMELQRSNQFVY
QLRRLFQEMIYSNKRCVQPSKELAYLSFLPLSQPVNFKNQKKTDYSGRTTIEENKQVQLA
ETKDNQSVGTESVHGELDGVLYQQSENGLSTDKDVTMTDGDDEINTEVKDIIDMDREVET
GMEIETDVDESNKNYSMAVESPSSSRSMIEDEVETPDTSSSEDDVVGSSPKILPISSDQI
ESTIEVGRQQDVTECIENVTYQIETALPPQLIDKDGEQHDLIKQLFCGKTKQTITPLDKP
DEPPRVSLERFFSLIINVSDHPKSIYDALDYYFNEDVVKLDEGLVKKSITISELPQILQF
HVQRVLFDREKLMAYKSIEPIPFSDKIYLDRYLDTDDEEILYKRNQVFEWKREISKLQQY
KFDLLKIDPETSVSLIDSLKITEKYLENKIISDDSLSIELSTIQTINDEIRKLTSNLEDI
DNRLNELNHLISIQFQDYKSIAYNIFAVFIHRGEASYGHYWVYIKDPHNNNIFRKYNDEI
VTEVPASEIFNFLETNTATPYYIVYIKEELESSYIEPLKREIKE
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atgatggataatgaagcaaccataccttcatctttagcttctacagaagcggaaaatgtc
gacacagagacaggaaactcagataaatcactttcccacatcaatcgatctagcaacttt
cctgaaactacatccaatcaattacaatcaaacaacccgtttcgctcatcaaccctgaca
gtatcggtaccatcactggagtcagtgccaatttctcaactaaggactagaattgcaaat
gcagaattggtgaactatccattcaaaactttgaatagaatcttggatgatttgaaatgg
acaattccagtccaagaaaaatataatttcagcatgttaaacagtaagccaatagattat
agtgaggaattgagtaaagttgttaattcgagtgtcatacattttgaaacattgatttta
aataatgatttggagtattgcaagtcagtcgaaaaagtcgagtattccaatagtcaacaa
gtgctttatattatgagaggtattttgctggataagaagcacgggacttatcatttcaga
ttagctgcattagaaaccgactctaacccttttgtaactaaactcattgataaacatcaa
tatcatgttatccccaaatccagcatatccgcacatgatttacaaattttgttggagaat
actatagatgttgataagattattgatgatgcatttttcaagagtttaaactcaccaaat
ggtcaaatcctaagggtaacattgttcaaagcagaattcacccaagaagatttagtaccg
ttgacggacgaggagataatacgagaacggtatttagaaggaattaagagacacccaaat
ctatccccggaaacaattccaaaccaactccattgtattaaaactttgataaaagtgtta
cgaggaccggttactttgaaacccgaggacaccatcaaaacaattaacctcaaaaataca
gttatggatgcacagatcgacgtcaatttactttttgagaaattgtcatttaccttaaat
ggggatgaagcagtaccaccagacttgaacaatttgccagacttgaaggaatcgtacata
agaaaaatcttggagttgatattctttgcgaaaaatgtaatggtgccaaataacgagttc
cagactttgtattcattttccgacaatatgtctcaagtgtttcacacgatcgttgaatac
gataaaaacgtgagtgtgagacatttcagtagcaattattcaaacagatttccatatttc
atcaatcttagcgcaagtgcttatttctccgatgaattgataataaaatgtttcgagctt
acagtgcagtctgactcaatcaaccagttatactatgtggattccttaaagcaaatacga
agtttcagaaacaataatgggggttattcagtaaacaataagcttgatatttatttcaga
cagagaaatttgataggctacagtgattttcttgagtcgatgaagatattgggattagca
gttgaaagcaatgaaacagaaacaattgatgatgatgttattattgcaatgtatcggagc
caatttaaaaatgatcccaagaattaccagtattataataatcatttgaaaagaattgct
ggtatcaaaaattccgagaaacttgatgattttattcagaaagagttgctaccaatcgat
ttagcacttgaagagttgagtattgaagagattacagaggatgatgttgtgatcactgca
tacgagttcaagcttgacgagttattgcaactgaatggattcaacggcaatgctaatgaa
gtcatttttttgaataaggcattactctcagttgcagttcatcgaagaagttacatatta
ttggagtatttggaaaccaaattacctgattacgtaaaaatacccacaatgaatgaaatg
actactcgcaaggcatttgaaacacttgatattgatgtccaagctctggaatctgaaatt
atcagtaattttcaaaataaatttctcaagggaaatgtcgatattcggttgttgagatac
gcattaaaattgattgctgaatccaagaaatcagagatattattaagtttcttgagaact
ggtaaaatagatacatcattactcccagcacaaaactggcctgctgggttagataatatt
gggaacacatgctacttaaattcgttattacaatattatttttgtataaaaccattacga
gaattgattttaacatttaatgagaacaattttagtgctaatgattaccctgaaacgaga
aagataggtgggagaaaagtagaaaatatggagcttcaaagatcaaatcaattcgtttac
cagttgcgtcggttatttcaagaaatgatttatagcaacaaaagatgcgttcaacctagt
aaagaattggcatatttatcttttcttccattgtcacaaccagttaatttcaaaaatcaa
aagaagaccgattatctgggtagaactacaattgaggaaaataaacaagttcaattagct
gaaaccaaggacaaccagagtgttggcacagaatctgtgcatggcgaacttgatggagta
ttatatcaacaatcagaaaatggactcagtactgataaagatgtaactatgactgatggc
gatgatgagatcaatacagaagtaaaggatattatagacatggatagggaagttgaaact
ggaatggaaattgaaacagatgttgatgaaagcaataaaaattattccatggccgttgaa
tcacccctgtcgtcaagatctatgattgaggatgaagtagaaacccctgatacttcttca
agtgaggatgacgttgtgggatcgagtcccaaaatattacccatactgagtgatcaaatt
gaaagcacaattgaagttggtagacagcaagatgtcactgaatgtattgaaaatgtcaca
tatcaaattgagacagcattaccaccacagttgatagataaagatggcgaacaacacgat
ttaatcaaacaattattttgcggcaaaactaaacaaaccatcactcccttggataaacct
gatgagccacctagagtttctttagaaaggtttttcagtttgattattaatgttagtgat
caccccaagagtatttatgacgcgttggattattactttaatgaagatgtggttaaattg
gatgaaggattagttaaaaaaagtattaccattctggaattgccacagattttgcaattc
catgtgcaacgagttttatttgatcgtgaaaaattgatggcatataaatcaattgaacca
attccgttcagtgataagatttatttggatagatacttggataccgatgacgaagaaatc
ttatataaaagaaaccaagtgtttgagtggaaacgtgaaattctgaaattacaacaatat
aaatttgatttattgaaaatcgaccctgagacatcggtgtcattgattgatagtttgaaa
atcacggaaaaatatcttgagaacaaaattatcctggacgattctttgagtattgaattg
tctaccatacaaacgattaatgatgagatcagaaaattaacatcgaatttagaagatatt
gataatcgattgaatgaattgaatcatttaataagtatacagttccaagattataaatcg
attgcatataatatatttgccgttttcattcatcgtggtgaagcaagctatgggcattat
tgggtatacatcaaagatccacataataataatatattccggaagtataatgatgaaatt
gtcactgaagttcctgctagtgaaatattcaatttcttggaaacaaacaccgctactcct
tattatattgtttatatcaaagaagaattagaatcaagttatatagaacctttaaaaagg
gaaattaaagaataa

DBGET integrated database retrieval system