KEGG   Candida albicans: CaO19.4718Help
Entry
CaO19.4718        CDS       T00189                                 

Gene name
TRP5
Definition
likely tryptophan synthetase alpha chain similar to S. cerevisiae TRP5 (YGL026C)
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cal  Candida albicans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.4718 (TRP5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CaO19.4718 (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CaO19.4718 (TRP5)
Enzymes [BR:cal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CaO19.4718 (TRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 702 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA
DGPTIQQANNIALDNGITVPKCLELLSQARDQGVTVPIILMGYYNPILKYGEQKFLKDAA
EAGANGFIVVDLPPEEAIKFRTECTKYGLSYVPLVAPATSNDRLKILGEIADSFIYVVSK
MGTTGASTKVSTGIQELCDRVRKYAGPDTPLAVGFGVSTREHFLTVGEVADGVVIGSKII
TLIGDSKPGERGKVAYDYVQSILGNDFKPNYPKTFERNNNNQAKETKPVLEENHKYNPRF
GDFGGQYVPEALHTCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHKAERLSEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVPVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKALNNGKLPNAVVACVGGGSNSTGMFSPFENDK
EVKLLGVEAGGDGLDTERHSATLTAGIPGVFHGVKTYVLQDNDGQVHDTHSVSAGLDYPG
VGPELAYWKSIGRAEFVAATDAQALEGFRLLSQLEGIIPALESSHAIYGAVELAKTMSKD
QHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEEDPSKV
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttacttaaagaaacattcgccagatgcaaaaaggaaggacgtaatgcctta
gttaatttcatcaccgcagggttccctaccattgacgataccattcctattttacaaaac
atgcaaaatgccggtgtcgacattattgaattgggtgttcccttctctgatccgattgct
gatggtcctactattcaacaagccaacaatattgccttagataacggaatcactgttcct
aaatgtttagaattattatctcaagccagagatcaaggtgtcaccgtgccaattattttg
atgggatattataatccaattttgaaatatggtgaacagaaatttttaaaagatgcagcc
gaagctggtgccaatgggttcattgtcgttgatttgccaccagaagaagcaatcaaattc
agaaccgagtgtaccaaatatggcttatcatatgtcccattggttgcccctgccacttct
aatgatagattaaaaattttgggagaaatcgccgattcatttatttatgttgtttctaaa
atgggtaccactggtgcttcaactaaagtttccacggggatccaagaattatgtgatcga
gtaagaaaatatgctggacccgatactccattagccgttggatttggggtttctactaga
gaacattttttgaccgttggtgaagttgccgatggtgtagttattggatcaaaaattatc
actttgattggtgattctaaaccaggtgaaagaggtaaagttgcttatgattacgtccaa
tctattttaggtaatgacttcaaacctaattatcctaaaacttttgaaagaaataacaat
aaccaagctaaagaaactaaaccagttttggaagaaaaccacaaatataatccaagattc
ggtgatttcggtggtcaatatgtccctgaagcattacacacctgtttggctgaattagaa
aaaggatttgaagatgccgttgctgatcctgaattttggaaagaatttagagatttatat
tcatacattggaagaccttcttctttacacaaggcagaaagattatctgaacatgctggg
ggagcacaaatctggttgaaaagagaagatttgaaccatactggttcccataaaatcaat
aatgctttggctcaagtgttaattgccaagagattaggtaaaaagaaaatcattgctgaa
actggtgctggtcaacatggtgtcgccactgctactgcttgtgccaagtttggattggaa
tgtactgtattcatgggagctgaagatactagacgtcaagcattgaatgttttcagaatg
aaaattttaggtgctaatgttgtcccagttaaaaatgggactcaaactttaagagatgcc
acttctgaagcttttagattttgggtatctaatttagaaactactcattatgttgttgga
tcagcaattggtcctcacccatatcctactttggttagaactttccaaagtgtcattggc
caagaaaccaaagaacaattcaaagctttaaacaatggtaaattgcccaatgcagttgtt
gcttgtgttggtggtggttccaactccactggtatgttttctccatttgaaaacgataaa
gaagttaaattattaggggttgaagccggtggtgatggcttagatactgaacgtcattct
gccactttaacagctggtattcctggtgttttccatggggttaagacttatgttttgcaa
gataatgatggtcaagtccatgatactcattctgtatctgctggtttggattatccaggt
gttggtccagaattggcttattggaagagtattggtagagccgagtttgttgctgctact
gatgcacaagctttggaagggttcagattattatcacaattggaaggtatcattcctgct
ttggaaagttctcatgctatttatggtgctgttgaattggctaaaacaatgtctaaagac
caacatattgtcatcaatgtatctggtagaggtgataaagatgtccaatcagttgccgaa
gtattgcctaaattgggtgaacaaattggctgggacttgagatttgaagaagatccttca
aaagtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system