KEGG   Candida albicans: CaO19.4718Help
Entry
CaO19.4718        CDS       T00189                                 

Gene name
TRP5
Definition
(RefSeq) likely tryptophan synthetase alpha chain similar to S. cerevisiae TRP5 (YGL026C)
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cal  Candida albicans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CaO19.4718 (TRP5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CaO19.4718 (TRP5)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CaO19.4718 (TRP5)
Enzymes [BR:cal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CaO19.4718 (TRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 702 aa AA seqDB search
MSALLKETFARCKKEGRNALVNFITAGFPTIDDTIPILQNMQNAGVDIIELGVPFSDPIA
DGPTIQQANNIALDNGITVPKCLELLSQARDQGVTVPIILMGYYNPILKYGEQKFLKDAA
EAGANGFIVVDLPPEEAIKFRTECTKYGLSYVPLVAPATSNDRLKILGEIADSFIYVVSK
MGTTGASTKVSTGIQELCDRVRKYAGPDTPLAVGFGVSTREHFLTVGEVADGVVIGSKII
TLIGDSKPGERGKVAYDYVQSILGNDFKPNYPKTFERNNNNQAKETKPVLEENHKYNPRF
GDFGGQYVPEALHTCLAELEKGFEDAVADPEFWKEFRDLYSYIGRPSSLHKAERLSEHAG
GAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATACAKFGLE
CTVFMGAEDTRRQALNVFRMKILGANVVPVKNGTQTLRDATSEAFRFWVSNLETTHYVVG
SAIGPHPYPTLVRTFQSVIGQETKEQFKALNNGKLPNAVVACVGGGSNSTGMFSPFENDK
EVKLLGVEAGGDGLDTERHSATLTAGIPGVFHGVKTYVLQDNDGQVHDTHSVSAGLDYPG
VGPELAYWKSIGRAEFVAATDAQALEGFRLLSQLEGIIPALESSHAIYGAVELAKTMSKD
QHIVINVSGRGDKDVQSVAEVLPKLGEQIGWDLRFEEDPSKV
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctttacttaaagaaacattcgccagatgcaaaaaggaaggacgtaatgcctta
gttaatttcatcaccgcagggttccctaccattgacgataccattcctattttacaaaac
atgcaaaatgccggtgtcgacattattgaattgggtgttcccttctctgatccgattgct
gatggtcctactattcaacaagccaacaatattgccttagataacggaatcactgttcct
aaatgtttagaattattatctcaagccagagatcaaggtgtcaccgtgccaattattttg
atgggatattataatccaattttgaaatatggtgaacagaaatttttaaaagatgcagcc
gaagctggtgccaatgggttcattgtcgttgatttgccaccagaagaagcaatcaaattc
agaaccgagtgtaccaaatatggcttatcatatgtcccattggttgcccctgccacttct
aatgatagattaaaaattttgggagaaatcgccgattcatttatttatgttgtttctaaa
atgggtaccactggtgcttcaactaaagtttccacggggatccaagaattatgtgatcga
gtaagaaaatatgctggacccgatactccattagccgttggatttggggtttctactaga
gaacattttttgaccgttggtgaagttgccgatggtgtagttattggatcaaaaattatc
actttgattggtgattctaaaccaggtgaaagaggtaaagttgcttatgattacgtccaa
tctattttaggtaatgacttcaaacctaattatcctaaaacttttgaaagaaataacaat
aaccaagctaaagaaactaaaccagttttggaagaaaaccacaaatataatccaagattc
ggtgatttcggtggtcaatatgtccctgaagcattacacacctgtttggctgaattagaa
aaaggatttgaagatgccgttgctgatcctgaattttggaaagaatttagagatttatat
tcatacattggaagaccttcttctttacacaaggcagaaagattatctgaacatgctggg
ggagcacaaatctggttgaaaagagaagatttgaaccatactggttcccataaaatcaat
aatgctttggctcaagtgttaattgccaagagattaggtaaaaagaaaatcattgctgaa
actggtgctggtcaacatggtgtcgccactgctactgcttgtgccaagtttggattggaa
tgtactgtattcatgggagctgaagatactagacgtcaagcattgaatgttttcagaatg
aaaattttaggtgctaatgttgtcccagttaaaaatgggactcaaactttaagagatgcc
acttctgaagcttttagattttgggtatctaatttagaaactactcattatgttgttgga
tcagcaattggtcctcacccatatcctactttggttagaactttccaaagtgtcattggc
caagaaaccaaagaacaattcaaagctttaaacaatggtaaattgcccaatgcagttgtt
gcttgtgttggtggtggttccaactccactggtatgttttctccatttgaaaacgataaa
gaagttaaattattaggggttgaagccggtggtgatggcttagatactgaacgtcattct
gccactttaacagctggtattcctggtgttttccatggggttaagacttatgttttgcaa
gataatgatggtcaagtccatgatactcattctgtatctgctggtttggattatccaggt
gttggtccagaattggcttattggaagagtattggtagagccgagtttgttgctgctact
gatgcacaagctttggaagggttcagattattatcacaattggaaggtatcattcctgct
ttggaaagttctcatgctatttatggtgctgttgaattggctaaaacaatgtctaaagac
caacatattgtcatcaatgtatctggtagaggtgataaagatgtccaatcagttgccgaa
gtattgcctaaattgggtgaacaaattggctgggacttgagatttgaagaagatccttca
aaagtatag

DBGET integrated database retrieval system