KEGG   Candida albicans: CaO19.4736Help
Entry
CaO19.4736        CDS       T00189                                 

Definition
vacuolar alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cal  Candida albicans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cal00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 551 aa AA seqDB search
MGLSNDQSPLLGGDSLTCWNKKQSGIKRNLSYLLNIITIGIIAYLCIFAKHSDNDDNTGL
SLNPQKKKNIIMMVTDGMGPASLSAARSFRQFRDKLAINDILTLDKYLIGSSRTRSSSSL
VTDSAAGATAFSCALKSYNGAIGVTPDKTPCGTVLEALKLQGYYTGLVVTTRITDATPAA
FSSHVDYRFQEDLIAQHQLGEYPFGRAVDLILGGGRCHFLPTSEGGCRADNRNLIKEYSD
KWQYVGDRVSFDQLQGGKNVSLPLLGLLANTDIPYDIERKDSEYPSLAEQVQVALTALSE
ATKDSEQGFFLLIEGSRIDHASHHNDPAAHVREVLAYDRAFEEVIKFIDNSEIETVAIST
SDHETGGLVVARQVSESYPDYLWYPEVLLNSTHSGDYLSHKVVHYKEKDNTKKFTNFIKH
EILEKDLGISDYTAKDVDLIIEKANNAGELLYVLNNIVSIRAQIGWTTHGHSAVDVNIYA
HTNSPAIKSKLLSHKAYDGLSGNHENIEIGAFIEYITGSDLNQVTQLIKKTEHSPDNNKA
KVDDIFHANVL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgggtttatcaaatgatcaaagtcctttacttggaggcgatagcttaacatgttggaac
aagaaacaatcaggcattaaaagaaatttgtcttatttgctcaatattataaccattggt
atcattgcatatttgtgcatatttgccaaacactctgataacgatgataataccgggctt
tcattgaatccccagaagaaaaagaacattatcatgatggttactgatggtatgggtcca
gctagtttatctgcagctagatcatttagacaatttagagataaattagccatcaatgat
attttgactcttgataaatatcttattgggtcctctcgtacaagatcttcgagcagtttg
gttacagactcggctgctggggccactgcattttcttgtgctttgaaatcgtataacggt
gcaattggtgtaaccccagacaagactccatgtggtactgttttagaagcattaaaatta
caaggttactacactggtttagtggtcactactagaataaccgatgccactcctgctgca
tttagttctcatgttgattacagatttcaggaagatttgattgcccaacatcaattaggt
gaatacccttttggaagagcagtagaccttattttaggtggaggaagatgccacttttta
ccaacttctgaaggtggctgtcgtgctgacaatagaaatttgattaaagagtacagcgat
aaatggcaatatgtcggtgatagagtgctgttcgatcaattacagggagggaaaaacgta
tcattgccattattgggattgttagctaacacagacatcccatatgacattgaacgtaag
gattcagaatacccttcattagctgaacaagttcaagttgcattaacagctttatcagag
gctaccaaggactctgaacaagggttctttttgttgattgaaggttctagaattgaccac
gcttcacaccacaatgatcctgccgcacatgtgagagaagttttagcttacgatagagca
tttgaggaagtgatcaagtttatcgacaatagtgaaattgaaaccgttgcaatttccacc
agtgaccatgaaactggtggtttagttgttgccagacaagtttctgagctgtatcctgat
tatttgtggtatcctgaagtattattgaacagcactcattccggggactacttgtcacac
aaggtggtacactataaggagaaagacaataccaagaaattcacaaactttatcaagcat
gaaatattagagaaagatttgggtattagtgattacactgcgaaagacgttgatttgatc
atcgaaaaggcaaacaatgctggggagttgctttacgtgttaaataatattgtttcaatt
agagctcaaattggatggaccactcacggtcactctgctgtagatgttaacatttatgct
cacaccaattctcctgctattaagtcgaaattgctctcacacaaagcttacgatggatta
tctggaaatcacgaaaatattgaaataggagcatttattgagtatatcactgggtcagat
ttgaatcaagtaacccaattgataaagaaaacagaacattctccagacaacaataaagcc
aaggtggatgacattttccatgcaaacgtattataa

DBGET integrated database retrieval system