KEGG   Candida albicans: CaO19.4747Help
Entry
CaO19.4747        CDS       T00189                                 

Gene name
HEM14
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cal  Candida albicans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CaO19.4747 (HEM14)
Enzymes [BR:cal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CaO19.4747 (HEM14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 531 aa AA seqDB search
MTLTTLPQNAKVAVLGAGISGLTFTYFLSKLRPDLQFTIFEKSKRPGGWMSSPKLHVNNT
NESILFEKGPRTLRGVKDGTLLMLDILRKLDLDSQIEVINEKCNANKKYILDSSGEIIQV
PNSIGTTIEFLKNVKCVDRKLITGILKEPFVKPIKEDETIEQFFKRRLGSTVLTDNVASS
IIHGIYAGDVGKLSIKSIMSFMKDIENQSGSIVKHIFKSLYSNKKKEEPQLSQELQIYNQ
LMSPKAELLTLQKTLKQYPMIKLHDGMETLPKYLAEYLINNTNTKIKYNTSIQDIDAVTG
KINGESYDHIRSTINTHDLAKTLPTTDPLVPELKSIEYVSIFLTNVYSRSSNLIPKGKPG
FGFLSPRYGNVWKNPDALLGTIYDSDIENNVEGLFVDTKPVHNPNNKITIMMGGHYYTNW
TIPSNSVNLKIVKDVLTSKLKVDLSKFNLKVIKDGEPLQIDEINDNDLVISYSFHSNCIP
QYNLGYQETKDKVNQLLDKGYKLSFGGTVFADGVGVPDCVLNGFKDALKLK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgactttgacaactctacctcaaaatgcaaaagtggcagttttaggagcaggaattctg
ggattaacattcacatatttcctttctaaactacgcccagatttacaattcacaatattt
gaaaaactgaaaagaccaggtggttggatgtcatcacctaaattacacgtcaataatacc
aatgaatcgattctttttgaaaagggaccaagaactttacgtggagttaaagatgggact
ttattaatgcttgatattttaagaaaattagatttggattctcaaatagaagtgattaat
gaaaaatgtaatgccaataagaaatatatacttgattcttcaggggaaatcattcaagtg
cctaattcaattggaacaacaattgaatttcttaaaaatgttaaatgtgtcgatagaaaa
ttaataactgggatattaaaggaaccatttgtgaaaccaataaaagaagatgaaacgatt
gaacaatttttcaaaagaagattaggtagtaccgtacttacagataatgttgccagttct
attattcatgggatatatgctggagatgtcgggaaattgagtattaaaagtattatgtca
tttatgaaagatattgaaaatcaatcaggttcaatagtgaaacatattttcaaatcccta
tattcaaacaagaaaaaagaggaaccacaattatcacaggaattacaaatatacaatcag
ttaatgtctccaaaagcggaattgttgactctacaaaaaacattgaaacaataccctatg
attaaattgcatgatggaatggaaaccttacctaaatatttagctgaatatttaatcaat
aacaccaacacaaagatcaaatataatacttctatacaagatatagatgctgtgacaggg
aaaatcaatggtgaatcatatgatcatatccgatccactattaatacccatgacttagca
aaaacattaccaacaacagatccattagtacctgaattgaaatccatagaatacgtcagt
atctttttaaccaatgtttattcaagatcgtcaaatttgatacctaaaggtaaaccaggg
tttggatttttatcaccacgatatggaaatgtttggaaaaatcctgatgcattattagga
acaatttatgattctgatattgaaaataatgtcgaaggactctttgttgatactaaacct
gttcataatccaaataataaaatcaccattatgatgggtggtcattattatacaaattgg
acaattccttcgaattcagtgaatttgaaaattgttaaagatgtattgacatcaaaatta
aaagttgatttatcaaaattcaatctaaaagtgattaaagatggtgaaccattacaaata
gatgaaattaatgacaatgatcttgtgatttcatatagtttccattcaaattgtattccc
caatataatttgggttatcaagaaacaaaagataaagtaaatcaattactcgataaaggt
tataagctttcatttggaggaacggtgtttgctgatggtgttggtgttcccgattgtgtg
ttgaatgggttcaaagatgccttgaaattgaaatag

DBGET integrated database retrieval system