KEGG   Candida albicans: CaO19.4747Help
Entry
CaO19.4747        CDS       T00189                                 

Gene name
HEM14
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cal  Candida albicans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cal00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 531 aa AA seqDB search
MTLTTLPQNAKVAVLGAGISGLTFTYFLSKLRPDLQFTIFEKSKRPGGWMSSPKLHVNNT
NESILFEKGPRTLRGVKDGTLLMLDILRKLDLDSQIEVINEKCNANKKYILDSSGEIIQV
PNSIGTTIEFLKNVKCVDRKLITGILKEPFVKPIKEDETIEQFFKRRLGSTVLTDNVASS
IIHGIYAGDVGKLSIKSIMSFMKDIENQSGSIVKHIFKSLYSNKKKEEPQLSQELQIYNQ
LMSPKAELLTLQKTLKQYPMIKLHDGMETLPKYLAEYLINNTNTKIKYNTSIQDIDAVTG
KINGESYDHIRSTINTHDLAKTLPTTDPLVPELKSIEYVSIFLTNVYSRSSNLIPKGKPG
FGFLSPRYGNVWKNPDALLGTIYDSDIENNVEGLFVDTKPVHNPNNKITIMMGGHYYTNW
TIPSNSVNLKIVKDVLTSKLKVDLSKFNLKVIKDGEPLQIDEINDNDLVISYSFHSNCIP
QYNLGYQETKDKVNQLLDKGYKLSFGGTVFADGVGVPDCVLNGFKDALKLK
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgactttgacaactctacctcaaaatgcaaaagtggcagttttaggagcaggaattctg
ggattaacattcacatatttcctttctaaactacgcccagatttacaattcacaatattt
gaaaaactgaaaagaccaggtggttggatgtcatcacctaaattacacgtcaataatacc
aatgaatcgattctttttgaaaagggaccaagaactttacgtggagttaaagatgggact
ttattaatgcttgatattttaagaaaattagatttggattctcaaatagaagtgattaat
gaaaaatgtaatgccaataagaaatatatacttgattcttcaggggaaatcattcaagtg
cctaattcaattggaacaacaattgaatttcttaaaaatgttaaatgtgtcgatagaaaa
ttaataactgggatattaaaggaaccatttgtgaaaccaataaaagaagatgaaacgatt
gaacaatttttcaaaagaagattaggtagtaccgtacttacagataatgttgccagttct
attattcatgggatatatgctggagatgtcgggaaattgagtattaaaagtattatgtca
tttatgaaagatattgaaaatcaatcaggttcaatagtgaaacatattttcaaatcccta
tattcaaacaagaaaaaagaggaaccacaattatcacaggaattacaaatatacaatcag
ttaatgtctccaaaagcggaattgttgactctacaaaaaacattgaaacaataccctatg
attaaattgcatgatggaatggaaaccttacctaaatatttagctgaatatttaatcaat
aacaccaacacaaagatcaaatataatacttctatacaagatatagatgctgtgacaggg
aaaatcaatggtgaatcatatgatcatatccgatccactattaatacccatgacttagca
aaaacattaccaacaacagatccattagtacctgaattgaaatccatagaatacgtcagt
atctttttaaccaatgtttattcaagatcgtcaaatttgatacctaaaggtaaaccaggg
tttggatttttatcaccacgatatggaaatgtttggaaaaatcctgatgcattattagga
acaatttatgattctgatattgaaaataatgtcgaaggactctttgttgatactaaacct
gttcataatccaaataataaaatcaccattatgatgggtggtcattattatacaaattgg
acaattccttcgaattcagtgaatttgaaaattgttaaagatgtattgacatcaaaatta
aaagttgatttatcaaaattcaatctaaaagtgattaaagatggtgaaccattacaaata
gatgaaattaatgacaatgatcttgtgatttcatatagtttccattcaaattgtattccc
caatataatttgggttatcaagaaacaaaagataaagtaaatcaattactcgataaaggt
tataagctttcatttggaggaacggtgtttgctgatggtgttggtgttcccgattgtgtg
ttgaatgggttcaaagatgccttgaaattgaaatag

DBGET integrated database retrieval system