KEGG   Candida albicans: CaO19.4892Help
Entry
CaO19.4892        CDS       T00189                                 

Gene name
TPK3
Definition
cAMP-dependent protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cal  Candida albicans
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cal00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CaO19.4892 (TPK3)
Enzymes [BR:cal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CaO19.4892 (TPK3)
Protein kinases [BR:cal01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CaO19.4892 (TPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 405 aa AA seqDB search
MTSMEPADTSIRSLNDINLQELANKQHQRNIYAQGSPTLEDSITSNGNDINNPNNNINKT
NNNSNSSLSLTKKTSRHINKDTTTKGKYTLNDFQILRTLGTGSFGRVHLTRSIHNGRFYA
MKVLKKQRVVQMKQIEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGGELFS
LLRKSQRFPTPVAKFYAAEVFLAIEYLHSLDIIYRDLKPENILLDKNGHIKLTDFGFAKE
VQDVTYTLCGTPDYIAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENI
LNGSITYPDYLPPDILDLLQKLIVKDLTQRLGNLQGGSDDVKNHPWFKEVIWERLLSRDI
ETPYEPPITSGVGDTSQFDRYPEDKDLDYGISGVEDPYRDQFQDF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacatccatggaaccagcagacacaagcatcaggtcattaaacgacatcaacttacaa
gaacttgccaacaaacaacatcaacgaaatatatatgctcaaggatcacctacactagaa
gattcaataacatcaaatggtaatgatattaataatcccaacaataatataaataaaacc
aataataacagtaattcaagtctttccttgaccaagaaaacatcaagacatatcaataaa
gacactacaactaaaggcaaatatacattaaatgattttcaaatattacgaacattagga
acaggttcctttggtagagttcatttaactcgatcgattcataatggtagattttatgct
atgaaagtattaaagaaacaacgagtagtacaaatgaaacaaatcgaacatactaatgat
gaaagaagaatgttaaaattagctcaacatccatttataattcgaatgtgggggacattc
caagattgtcataatttatttatgattatggattatatagaaggaggtgaattattttca
ttattaagaaaatcacaacgattccctactccagtagctaaattttatgctgccgaagta
tttttggctattgaatatttacacagtttagacattatttatcgagatttaaaaccggaa
aatatattattggataaaaatggtcatatcaaattaactgattttggatttgctaaagaa
gttcaagatgtgacttatactttatgtgggactccagattatattgctcctgaagtggtg
gcaacaaaaccttataataaatcagttgattggtggtcatttggtatattaatatttgaa
atgttaactggttatactccattctatgatcctactccaatgaaaacttatgaaaacatt
ttaaatggatcaattacttatcctgattatttacctccagatatattggatcttctacaa
aaattaattgtcaaagatttaactcaaagattaggtaatttacaaggtggttctgatgat
gtgaaaaatcatccgtggtttaaagaagtaatttgggaaagattattgtcacgtgatata
gaaactccatatgaaccacctataacttcaggtgttggtgatacttcacaatttgatcga
tacccagaagataaagatttggattatggtataagtggagttgaagacccatatcgtgat
caattccaggacttttaa

DBGET integrated database retrieval system