KEGG   Candida albicans: CaO19.4979Help
Entry
CaO19.4979        CDS       T00189                                 

Gene name
KNS1
Definition
Serine/threonine protein kinase
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cal  Candida albicans
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 666 aa AA seqDB search
MISNRKRPRVLSTDGHSSVSNDTATNSTNLSDTPPFSHHHHHHHSQQSQQQQQQQMPILS
DTSTDSSNSSFPFYKPLLKSSKIESSMFTNPFLSIHDRNGIQLPEYGDDDDNEEDEEDEI
SDNVLDNDDDDNYAIEDDDEEVDEDEIVDIEDDDDDIEEIDGFDNDDDIIFIEQRQLPKR
NSDSLLYDTQALEAYNKFRSNKNNNNKKKLPPARIKKQRTNSLPQLPQAKCIYNKLPNYI
LQGPKLGNIRTNVIPHQLNLPPCVDESGHYIVKPNTLFANRFIIIKLLGQGTFGKVVQCF
DKVKNEHVAIKIIRNIQKYRDAAKIELRVLSTLKKFDPDNTNHCIHLRECFDYRGHICIV
TDLLKISLYDFLENNKYIGFPGSQIQSIAKQLIRTVCFLHDLGIIHTDLKPENVLLKDDS
YHKLKITSSTMTSAYLALKNDKRPVKFSKILSLTDIYVIDFGSSIFDSEYHSSVVSTRHY
RAPEIIFNCGWSFAIDLWSVGCILVELIIGEPLFKTHHDQEHLHMIQKISGETIDRKMVL
MCKKQGHKVGEYFDDNCRLIELEEPKFIQSVAQLDRIDKFISKRLGINLDLNLSLEENYD
LNRDNQEEDDDKDEEDDFDENKILFYYYFVDLLQSLLKINPQERITAEEAMNHPWFDLGT
IDEGIV
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattagtaatagaaagagaccaagagttttaagtactgatggacattcgagtgtttct
aatgacacagctacaaattctacaaatctatcagatacacctccttttagtcaccatcac
catcatcatcacagtcaacaactgcaacaacaacaacaacaacaaatgccaattttatct
gatacttcaactgattcaagtaattcaagtttcccattttataaaccattacttaaaagt
agtaaaattgaatcaagtatgtttactaatccatttttatcaattcatgacaggaatggg
atacaattgcctgaatatggtgatgacgacgataacgaagaagacgaggaggatgaaatt
agcgataatgtccttgacaatgatgacgatgataattatgcaatagaagatgatgatgaa
gaagtggatgaagatgaaatagttgatatcgaagacgatgatgacgatattgaagaaatt
gatgggtttgataatgatgatgacattatattcattgaacaacgtcagctacccaagaga
aatagtgatagtttattatatgatacacaagcattggaagcttataataaattcaggtcg
aataagaataataataacaagaaaaagctacctccagctcgtatcaaaaagcaacgaact
aattcattaccacaattaccacaagccaaatgtatttataataaattacccaattatatt
ttacaaggacctaaattgggtaatatacggaccaatgtgatacctcatcaattgaattta
cctccatgtgtggatgaaagtgggcattatattgtcaaaccaaatacattatttgccaat
agatttattattattaaattgttgggtcaaggaacatttggtaaagttgtacaatgcttt
gataaagttaagaatgaacatgttgccattaaaataattcgtaacatacaaaaatatcgt
gacgcggccaaaattgaattgagagtgttgtctacactaaagaaatttgatccagataac
actaatcattgtattcatttacgagaatgttttgattatcgtggtcatatttgtattgtt
actgatttactcaagatttcattatatgattttttggaaaataataaatatattggattt
ccagggagtcaaattcaatcaatagctaaacaattgatacgaacagtttgctttttacat
gatttaggaatcattcataccgatttaaaaccagaaaatgttttacttaaagatgatagt
tatcataaattgaaaataactagtctgacaatgacttcagcttatttagccttgaaaaat
gataaacgaccagtgaaatttctgaaaatcttgagtttaaccgatatttatgtgattgat
tttggtagttcaatatttgatagtgaatatcattcactggtggtttcaactcgacattat
cgagccccagaaatcattttcaattgtggttggtcatttgctattgatttatggtctgtc
gggtgtatattagtggaattaattattggtgaaccattatttaaaactcatcatgatcaa
gaacatttgcatatgattcaaaaaatatcgggtgaaactattgatcgaaaaatggtttta
atgtgtaaaaaacaaggtcataaagttggagaatattttgatgataattgtcgattaatt
gaattggaagaaccaaaattcattcaatcagtggctcaattggatagaattgataaattt
atttcgaaaagattaggaattaatcttgatttgaatttatcattagaagaaaattatgac
cttaatagggataatcaagaagaagatgatgataaagatgaggaggatgattttgatgag
aataagattttgttttattattattttgttgatttgttacaaagtttattgaaaattaat
ccacaagaaagaattactgctgaagaagcaatgaatcatccttggtttgatttaggtact
atagatgaaggaattgtgtga

DBGET integrated database retrieval system